KEGG   Bacillus subtilis subsp. subtilis 168: BSU13700Help
Entry
BSU13700          CDS       T00010                                 

Gene name
clpE
Definition
(RefSeq) ATP-dependent Clp protease ATP-binding subunit ClpE
  KO
K03697  ATP-dependent Clp protease ATP-binding subunit ClpE
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU13700 (clpE)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP100
   BSU13700 (clpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_2 AAA_lid_9 AAA ClpB_D2-small AAA_5 Sigma54_activat AAA_16 TniB RuvB_N AAA_22 AAA_7 AAA_14 AAA_18 IstB_IS21 UVR NACHT AAA_3 RNA_helicase ResIII Zeta_toxin AAA_33 RsgA_GTPase AAA_25 Torsin ABC_tran TsaE DNA_pol3_delta2 TIP49 zf-SNAP50_C
Motif
Other DBs
NCBI-GeneID: 939289
NCBI-ProteinID: NP_389253
Pasteur: BG12578
BSORF: BG12578
UniProt: O31673
Position
complement(1435628..1437727)
Genome map
AA seq 699 aa AA seqDB search
MRCQHCHQNEATIRLNMQINSVHKQMVLCETCYNELTRKPSMSMGPQSFGFPFEQAFQPK
EQSAAKQSEKKGLLDELAQNITNGAKAGLIDPVIGRDDEVARVIEILNRRNKNNPVLIGE
PGVGKTAIAEGLALKIAEGDVPNKLKNKELYLLDVASLVANTGIRGQFEERMKQLITELK
ERKNVILFIDEIHLLVGAGSAEGSMDAGNILKPALARGELQVIGATTLKEYRQIEKDAAL
ERRFQPVMVQEPSIEQAILILQGIKDKYEAYHGVTFSDEAIKACVTLSSRYIQDRHLPDK
AIDLLDEAGSKANLLIDELNDEDAAERLTAIEAEKTKALEEENYELAAKLRDEELALEKK
LNSSSAHTAVTVEAEHIQEIVEQKTGIPVGKLQADEQTKMKELEAKLHERVIGQEAAVQK
VAKAVRRSRAGLKSKNRPVGSFLFVGPTGVGKTELSKTLADELFGTKDAIIRLDMSEYME
KHAVSKIIGSPPGYVGHEEAGQLTEKVRRNPYSIVLLDEIEKAHPDVQHMFLQIMEDGRL
TDSQGRTVSFKDTVIIMTSNAGAGEKQTKVGFQSDDSVIEEQTLIDSLSMFFKPEFLNRF
DSIIEFRSLEKEHLVKIVSLLLGELEETLAERGISLNVTDEAKEKIAELGYHPSFGARPL
RRTIQEWVEDEMTDLLLDNGEITSFHVILEDDKIKVRAK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgcgttgtcaacattgtcatcaaaacgaggcgacgattcgccttaacatgcaaataaat
tccgttcataaacagatggttctttgtgaaacttgctataacgaactgacccgtaaacct
tcaatgagtatgggtcctcaatctttcggatttccgtttgaacaggcattccagccgaaa
gaacagagcgcagcaaaacaaagcgaaaaaaaagggttgcttgatgagctggctcaaaat
attacaaacggtgcaaaagccggtctcattgatcccgtcatcggccgtgatgatgaagtg
gcgcgagtgatcgaaattctaaaccgccgaaacaaaaacaatccggttcttattggtgag
ccgggtgtagggaaaactgccatcgctgaagggctcgctttaaaaattgctgaaggtgat
gttccaaacaaactaaaaaacaaagagctatacttgcttgatgttgcatctcttgttgca
aacacagggatcagaggccaatttgaggagagaatgaaacagctgatcactgagctgaag
gaacgaaaaaatgtcattctgttcattgatgaaattcaccttctcgtcggcgcaggctct
gcagaaggatcaatggacgccggcaacattctcaaaccggccctagccagaggcgaactg
caagtcattggcgcgacaacactgaaagaatatcgtcaaatcgaaaaagatgccgcgctg
gaaagacgttttcagcctgtcatggtgcaggagccttcaattgaacaggctatcctcatt
ctgcaagggattaaagacaaatacgaggcgtaccatggcgtaacattcagtgatgaagca
atcaaagcatgtgtcactttatcatcccgctacattcaggacagacacctgccggataaa
gcaattgatttattagatgaagcaggttcaaaagccaacctgttaattgatgaactgaat
gatgaggatgccgctgaacgcttaactgcaattgaagccgaaaaaacaaaagccctggaa
gaagaaaattacgaactggcggcaaaactccgtgatgaagaactcgcattggagaaaaaa
ctgaacagctcctccgctcataccgctgtcactgtggaagctgagcacattcaggaaatt
gttgaacaaaaaacaggcatccctgtcggcaaactgcaggcagacgaacaaacgaaaatg
aaagaactcgaagcaaaacttcatgaacgcgtgatcggacaagaagccgctgttcaaaaa
gtggcaaaagcggtaagacgaagccgcgccggattaaaatccaaaaacagaccagtcggc
tccttcctcttcgtcggtcctaccggcgtagggaaaacagagctttctaaaacactggca
gatgaattattcggcacaaaagacgctattatccgactcgatatgagcgaatacatggag
aaacacgccgtatctaaaattatcggttcaccgcctggatatgtcggccatgaggaagct
ggacaattaactgagaaggtgcgccgcaatccttacagcattgtgttgctggatgagatt
gaaaaagcacacccagacgttcagcatatgttcctgcaaattatggaagatggccgtctg
acagacagccaaggcagaactgtaagcttcaaagacactgtgatcatcatgacaagtaat
gcgggtgctggtgagaaacaaacgaaagtcggtttccaatcagatgacagtgtcatcgaa
gaacaaacattaattgattcactgagcatgttctttaaacctgagttcctcaaccgtttt
gacagcattattgagttccgctcattggaaaaagaacatcttgtcaaaatcgtcagcctt
cttcttggagaacttgaagaaacattggcggaacggggcattagcttgaatgtgacagat
gaagcgaaagaaaaaatcgctgagctgggctaccacccttcattcggtgcacgtccgctt
agaagaaccatccaagaatgggttgaggatgaaatgaccgatctgctgcttgataatggc
gagatcacaagttttcacgtgattttagaagatgataaaatcaaagtgcgagcaaaataa

DBGET integrated database retrieval system