KEGG   Bacillus subtilis subsp. subtilis 168: BSU13710
Entry
BSU13710          CDS       T00010                                 

Gene name
ykvI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939307
NCBI-ProteinID: NP_389254
Pasteur: BG13311
BSORF: BG13311
UniProt: O31674 A0A6M3ZAE6
Position
1438092..1439135
AA seq 347 aa
MEQSKGSASQLAFVYVGTVVGAGFATGREIVEFFLKFGWFGFFGILVSGGMFTLLGAKLM
IISKRINAKSYQEMNIFLFGATAGRIINVFMLFVLLGVTSVMLSGAGALFEEQLGMSAQI
GMLITIGLSLIVMTRGVKGIFGVNVFVVPLLIIFSMIVVADSFIFSESRNAAQWVWPHRW
DWLLSAVSYGALNLSLAQAVLVPLANEMSSEKVIKKGALIGGTMLTIVLSASFLSLSTLP
DVFLYDIPMAQVVYLFARSVHLIYLLIIFGEVFTSVIGNLYGLEKQVQSFLPVKSKYIFA
AIMITAYITSQIGYGRLISTIYPLFGYVSLAFIGALLCKKAPRRRSL
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggaacaatcaaaagggtctgcaagtcagcttgcttttgtgtatgtcggcacagtagtc
ggagctggatttgcgactgggagggaaattgttgagttttttctgaagttcggctggttc
ggttttttcggcattctcgtcagcggcggaatgtttacgttactgggggccaagctgatg
atcatttcaaagcgaatcaatgccaagtcatatcaagaaatgaacatatttttgttcggg
gcgacggctgggcggattatcaatgtatttatgctgtttgttctccttggagttacatct
gttatgctttcaggggcaggggcgctttttgaggaacagctggggatgtccgctcagatt
gggatgctcattacaatcggtctgagtttaattgtgatgactagaggagtaaaaggcatt
ttcggtgtcaatgtgtttgttgttcctcttttaatcatcttttcaatgattgtggtggcc
gactcttttatattcagcgaatcacgaaacgcagctcagtgggtctggccgcatcgctgg
gattggctgttatcagcagtttcttacggggctttaaatttatcgcttgcccaagctgtt
ttggttccgctggcgaatgaaatgtcatcggagaaagtgataaaaaaaggcgctttaatc
ggaggcacgatgctgacgattgtgctgtccgcgagttttctgtctttgtcgactcttccg
gatgtatttttgtatgatataccgatggcgcaagtggtttatctctttgcacgatctgtc
catttgatttatttactcattattttcggagaagtgttcacatcagttatcggtaatcta
tatggattagaaaaacaagtgcaaagctttcttccagtgaaaagcaaatatatctttgca
gccattatgatcacggcttatattacgagccaaatagggtacggcaggcttatttcaacg
atttatcccttgtttggctatgtgagcctggccttcataggcgctttgctttgcaaaaaa
gctcctcggcggcgcagtttataa

DBGET integrated database retrieval system