KEGG   Bacillus subtilis subsp. subtilis 168: BSU13720Help
Entry
BSU13720          CDS       T00010                                 

Gene name
queC
Definition
(RefSeq) 7-cyano-7-deazaguanine synthase QueC
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU13720 (queC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU13720 (queC)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     BSU13720 (queC)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU13720 (queC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC Asn_synthase Diphthami_syn_2 NAD_synthase ThiI ATP_bind_3 PAPS_reduct Arginosuc_synth tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 939292
NCBI-ProteinID: NP_389255
Pasteur: BG13312
BSORF: BG13312
UniProt: O31675
Structure
PDB: 

Position
1439448..1440107
Genome map
AA seq 219 aa AA seqDB search
MKKEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQRHSQEVEVAKSIAEKLGVKNH
LLDMSLLNQLAPNALTRNDIEIEVKDGELPSTFVPGRNLVFLSFASILAYQIGARHIITG
VCETDFSGYPDCRDEFVKSCNVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGALDFVK
NNTLTCYNGIIADGCGECPACHLRSKGYEEYMVMKGERA
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaaaagcaattgtcgtatttagcggcggtcaagacagcacaacatgctta
ctgtgggccttaaaagaattcgaagaagtcgaaacggtgacttttcattataatcagcga
cattcgcaggaagttgaagtggcaaaatccattgcggaaaagcttggtgtgaaaaatcat
ttgcttgatatgtcacttttaaatcagcttgcaccgaatgccctgactagaaatgatatt
gagatagaagtaaaagacggcgaactgccatccacattcgttccaggccgcaatttggta
ttcttatcctttgcgtctatcctggcttaccaaattggcgcgcgccacattattacagga
gtttgcgagacagacttcagtggttatcctgactgccgtgacgaattcgtgaaatcttgc
aatgtcacggtaaatctggcaatggagaagccgtttgtgatccacacgcctctcatgtgg
ctcaataaggcggaaacgtggaagcttgcagatgagcttggcgcgctggattttgtgaaa
aacaacacgctgacatgctataacggcatcatcgcagacggctgcggcgaatgtccggca
tgtcaccttcgttcaaaaggttatgaagaatatatggtgatgaaaggagagcgtgcataa

DBGET integrated database retrieval system