KEGG   Bacillus subtilis subsp. subtilis 168: BSU13730Help
Entry
BSU13730          CDS       T00010                                 

Gene name
queD
Definition
(RefSeq) 6-pyruvoyl tetrahydrobiopterin synthase
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU13730 (queD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU13730 (queD)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     BSU13730 (queD)
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     BSU13730 (queD)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU13730 (queD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS Bac_GH3_C
Motif
Other DBs
NCBI-GeneID: 939282
NCBI-ProteinID: NP_389256
Pasteur: BG13313
BSORF: BG13313
UniProt: O31676
Position
1440100..1440549
Genome map
AA seq 149 aa AA seqDB search
MHKLLSQIYPQAQHPYSFELNKDMHISAAHFIPRESAGACSRVHGHTYTVNITVAGDELD
DSGFLVNFSVLKKLVHGNYDHTLLNDHEDFSQDDRYSLPTTEVVAKTIYDNVQAYLDTLE
NKPTCVQVFVRETPTSYCVYRPKKGGLNG
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgcataaattgttatctcaaatttatccgcaggcccagcatccttattcgtttgaactg
aataaggacatgcatatctcagccgctcattttatccctcgggaaagtgcgggagcgtgc
agcagggttcacgggcatacgtataccgtaaatataaccgttgccggcgacgaacttgac
gattcaggctttcttgtcaatttcagcgtactcaaaaaactggtgcacggaaactatgat
cacacgctattaaatgatcatgaagatttttctcaggacgaccggtattcgctgccgaca
actgaagtcgtggcgaaaacgatttatgacaacgtacaggcttatttagacactttggag
aataagccgacctgtgtacaggtgtttgtccgtgaaacaccgacaagctactgtgtctac
cgtccgaaaaagggtggtttgaatggctaa

DBGET integrated database retrieval system