KEGG   Bacillus subtilis subsp. subtilis 168: BSU13740Help
Entry
BSU13740          CDS       T00010                                 

Gene name
queE
Definition
(RefSeq) 7-carboxy-7-deazaguanine synthase
  KO
K10026  7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU13740 (queE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU13740 (queE)
Enzymes [BR:bsu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     BSU13740 (queE)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU13740 (queE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12 Zwilch DUF4147
Motif
Other DBs
NCBI-GeneID: 939290
NCBI-ProteinID: NP_389257
Pasteur: BG13314
BSORF: BG13314
UniProt: O31677
Structure
PDB: 

Position
1440542..1441273
Genome map
AA seq 243 aa AA seqDB search
MAKGIPVLEIFGPTIQGEGMVIGQKTMFVRTAGCDYSCSWCDSAFTWDGSAKKDIRWMTA
EEIFAELKDIGGDAFSHVTISGGNPALLKQLDAFIELLKENNIRAALETQGTVYQDWFTL
IDDLTISPKPPSSKMVTNFQKLDHILTSLQENDRQHAVSLKVVIFNDEDLEFAKTVHKRY
PGIPFYLQVGNDDVHTTDDQSLIAHLLGKYEALVDKVAVDAELNLVRVLPQLHTLLWGNK
RGV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaggaattcctgtattagaaattttcggcccgacgattcaaggagaaggcatg
gtgatcggacagaaaacgatgttcgtccggacagccggctgcgattattcctgcagctgg
tgtgactccgctttcacttgggacgggtctgctaaaaaagatattcgctggatgacggcg
gaggagatttttgcggagcttaaggacattgggggagatgcgttttctcatgtgacgatc
tcaggcggcaacccggctctgttaaaacagctggatgcttttattgaactgctgaaggaa
aataacatccgtgcagcgcttgaaactcaagggaccgtttatcaggattggtttacgctg
attgatgacctgacaatttctccaaaaccgccaagctcaaaaatggtaacgaactttcaa
aagcttgaccacattttaacttcacttcaagagaatgatagacagcatgctgtcagcttg
aaggttgtcatctttaatgatgaagatctggaatttgccaaaactgtgcacaagcggtat
ccgggaatcccgttttatttacaagtcggaaatgatgacgtgcatacgacagatgatcag
tcactgattgcacatttgcttggaaaatatgaagcgcttgttgataaggtagctgtcgat
gcggagctgaatctcgtcagagtgctcccgcagctgcacaccctgttatggggcaacaaa
cgcggagtataa

DBGET integrated database retrieval system