KEGG   Bacillus subtilis subsp. subtilis 168: BSU13750Help
Entry
BSU13750          CDS       T00010                                 

Gene name
ykvM
Definition
(RefSeq) 7-cyano-7-deazaguanine reductase
  KO
K09457  7-cyano-7-deazaguanine reductase [EC:1.7.1.13]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00790  Folate biosynthesis
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BSU13750 (ykvM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU13750 (ykvM)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.13  preQ1 synthase
     BSU13750 (ykvM)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BSU13750 (ykvM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueF QueF_N
Motif
Other DBs
NCBI-GeneID: 939296
NCBI-ProteinID: NP_389258
Pasteur: BG13315
BSORF: BG13315
UniProt: O31678
Structure
PDB: 

Position
1441291..1441788
Genome map
AA seq 165 aa AA seqDB search
MTTRKESELEGVTLLGNQGTNYLFEYAPDVLESFPNKHVNRDYFVKFNCPEFTSLCPKTG
QPDFATIYISYIPDEKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPRYIEVW
GKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMMNHDLYPETIDNR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaagaaaagaatcagaattagaaggtgtaacattgctaggcaatcaaggtaca
aattatttgttcgaatatgcaccggacgtgctggaatccttccctaataaacatgtaaac
cgtgattactttgtaaaattcaattgcccggaattcacatctttatgtcctaaaacaggc
cagcctgactttgcgacaatctacatcagctacattcctgatgaaaaaatggttgaaagc
aaatcattaaagctgtatctattcagcttcagaaaccatggtgacttccacgaggactgc
atgaatatcatcatgaacgacttgattgaattaatggacccgcgctacattgaagtatgg
ggcaaattcacgccaagaggcggaatttccattgatccgtacacaaactacggaaagcct
ggcacgaagtatgagaaaatggccgaataccgtatgatgaaccatgatttgtatccggag
acaattgataatcgttaa

DBGET integrated database retrieval system