KEGG   Bacillus subtilis subsp. subtilis 168: BSU13760Help
Entry
BSU13760          CDS       T00010                                 

Gene name
ykvN
Definition
(RefSeq) HxlR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HxlR HTH_5
Motif
Other DBs
NCBI-GeneID: 939274
NCBI-ProteinID: NP_389259
Pasteur: BG13316
BSORF: BG13316
UniProt: O31679
Position
complement(1442347..1442703)
Genome map
AA seq 118 aa AA seqDB search
MKKFSCGFEVTKEVIGGKWKGLVLYFLMNGPKRTSELKRIIPNITQKMLIQTLRELEASG
LVSRKMYNQVPPKVEYSSTELGESLKPILQELCQWGGYYAEQEYAEGEYEIVQPEQLS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttagctgtgggtttgaagtgacaaaggaagttattggcggaaaatggaaa
ggccttgtattatactttttaatgaatggaccaaagagaacgagtgaattaaagcgcatt
atcccaaatataactcagaaaatgctgattcaaacacttagagagcttgaagccagtgga
cttgtgagcagaaagatgtataatcaagtaccgccgaaggttgaatattcatccactgaa
cttggagaatctcttaaacctatcttgcaggagctctgtcaatggggaggctattatgcg
gagcaagagtatgcagaaggtgaatatgaaattgtacaaccagaacaactaagttag

DBGET integrated database retrieval system