KEGG   Bacillus subtilis subsp. subtilis 168: BSU13770Help
Entry
BSU13770          CDS       T00010                                 

Gene name
ykvO
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd CwsA 3HCDH_N NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 939276
NCBI-ProteinID: NP_389260
Pasteur: BG13317
BSORF: BG13317
UniProt: O31680
Position
1442872..1443618
Genome map
AA seq 248 aa AA seqDB search
MGKFEGKIALVTGGTSGIGLATAQKFVNEGAYVYITGRRQNELDKAVNQIGKNVTGVQGD
ISKLEDLDKLYDIIKQEKGKLDILFANAGIGNFLPLGEITEEQVDRTFDINVKGTIFTVQ
KALSLFPDKVGSIIVTGSTAGSIGNPAFSVYGASKAALRALVRNWILDLKGTEIRVNVVS
PGGILTPAYDELFGDALEEVLENSRNTVPAGKVGTPEEVANAVSFLASDESSYLTGVELF
VDGGLAQV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatttgaaggtaaaatagcgcttgtaacgggtggaacaagtgggattggtctt
gctacagcacaaaaatttgtaaacgaaggtgcatatgtttatattacgggacgtagacaa
aacgaacttgataaagctgttaaccaaattggcaagaacgtaaccggtgttcaaggtgat
atttctaagcttgaagacttagacaaactatatgacattataaagcaggaaaaaggtaag
ttggacattctttttgctaatgcaggcatcggcaacttccttccattaggtgaaattact
gaagagcaggttgatagaacgttcgacattaacgttaaaggaaccatctttactgttcaa
aaagcgttatcactattcccggacaaagtaggttctattattgtaacgggctctactgct
ggatcaattggcaacccagcgtttagtgtatatggagcatctaaagcagcattaagagca
ctagttcgcaactggattcttgacctaaaaggtactgaaatccgtgtaaatgtggttagt
ccaggaggtattcttacacctgcctacgatgagctttttggtgatgcacttgaagaggta
ctggaaaatagcagaaatactgttccagctggaaaagttgggacacctgaagaagtagca
aacgctgtatctttccttgcttcagacgaaagcagttacttgacgggtgttgaattgttc
gtagatggcgggctagcacaggtataa

DBGET integrated database retrieval system