KEGG   Bacillus subtilis subsp. subtilis 168: BSU13780Help
Entry
BSU13780          CDS       T00010                                 

Gene name
ykvP
Definition
(RefSeq) spore protein YkvP
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_1_2 LysM DUF3880 B12-binding
Motif
Other DBs
NCBI-GeneID: 939278
NCBI-ProteinID: NP_389261
Pasteur: BG13318
BSORF: BG13318
UniProt: O31681
Position
1444099..1445298
Genome map
AA seq 399 aa AA seqDB search
MKILFLESHPMWLYGLPNGFREAGHTVMISGPVSRENITEMIDEFKPDLIVSMGWTPEHS
REKQAWIRNATKKVNIPLVYWATEDPLHTQNFTIPLIKKMKPDFVFTVTPSLCKTYESMG
IKAAHLDFAFHESIHHQIKPLAKYSCDIAVVANAYPNFLEEHPEVFRSSSLKTLIRPLIR
KGIRIDFWGRNWEKMSKYIGREIPRNWIHGYLDYTEAYKVYSSAKIIIGLQNCESQLTQR
TYEILGSGGFLLTSDTPAVRGKFKPGRDLIVSSSPKETLEKVKYYLNHDSERKKIQINGK
KAVKNDSYRHRAERMLEVLKSRGIIRNLGETIHYVDVLKEKYVIHHVTPGETLSIIASKY
NVSLQQLMELNHFKSDQIYAGQIIKIREKLFRNINNKLF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattcttttccttgagagtcatcccatgtggctctatggtttaccgaatgggttt
agggaagcaggacataccgtaatgatttccggtcctgtaagtcgggaaaatataactgaa
atgatagacgaatttaaaccagatttaatagtatctatgggatggacaccagagcattca
agggaaaagcaggcctggattcgcaacgctactaaaaaggtgaatatccctctcgtttat
tgggcaactgaagacccgctgcacactcaaaactttactatcccgttaattaaaaagatg
aaaccggattttgttttcacggtcacgccttctctgtgtaaaacttatgaaagcatgggg
attaaagcagctcacttagactttgcatttcacgaaagtatacatcaccagattaaacca
ttagcgaaatacagttgtgatatagcagtggtggctaatgcttaccctaattttcttgaa
gaacatccggaagtgttccgttcgtcctctttaaaaacgcttattcgtcctcttatacgg
aagggtattcgcattgatttttgggggagaaactgggaaaaaatgagtaaatatatagga
agagaaattccccgcaattggatccatggataccttgattatactgaagcatataaagtt
tacagttcagcaaaaatcattatcggtttgcaaaactgtgaaagccaacttacacaacgc
acctatgagattcttggttccggggggtttttattgacatcggatacaccagcagttcga
ggtaaattcaaacctggccgcgatctcatcgtttcttcctccccaaaagaaacattggaa
aaggttaaatactatttaaatcatgatagcgagagaaaaaagattcagataaacggtaaa
aaggctgtaaagaatgattcctatcggcatagagccgagagaatgcttgaggtgctaaaa
agcagaggaatcataagaaacttaggggaaaccattcattatgtagatgttctcaaagaa
aaatacgtgatccatcatgttactcccggtgaaacattatcaataattgccagtaagtat
aatgtttccctgcagcaactcatggagcttaatcatttcaaatcagatcaaatatatgct
ggacaaatcattaagattagagagaaactgtttagaaatattaataacaaattattctaa

DBGET integrated database retrieval system