KEGG   Bacillus subtilis subsp. subtilis 168: BSU13789Help
Entry
BSU13789          CDS       T00010                                 

Gene name
ykzQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM
Motif
Other DBs
NCBI-GeneID: 8303133
NCBI-ProteinID: YP_003097719
UniProt: C0H403
Position
1445314..1445541
Genome map
AA seq 75 aa AA seqDB search
MKGKIPKIRNQANKVKRTPRYMEFPVTYEVYHVESGDTLWTIAKSFEIPVQQLMNLNKLS
SDRIYPGQIIKIRER
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggaaaatacctaaaataagaaatcaagcgaataaagtaaaaagaacgcctcgt
tatatggaatttcccgtgacatacgaagtatatcatgtggaatccggcgatacattatgg
acgattgccaaatcctttgaaattccggtacaacaacttatgaatcttaataagctttct
tcagatagaatttatcctggacaaattataaagataagagaaagataa

DBGET integrated database retrieval system