KEGG   Bacillus subtilis subsp. subtilis 168: BSU13790Help
Entry
BSU13790          CDS       T00010                                 

Gene name
ykvQ
Definition
(RefSeq) glycosylase YkvQ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18
Motif
Other DBs
NCBI-GeneID: 939273
NCBI-ProteinID: NP_389262
Pasteur: BG13319
BSORF: BG13319
UniProt: O31682
Position
1445638..1446336
Genome map
AA seq 232 aa AA seqDB search
MFQMSYYYSGLGWDFIQHVDQTNGVLNVVSPDFFYIRKDGSLLLRSANPDVIKALHRRKL
KVVPFLSNHWDQDLGRFALMNRVLLAKQISHAIEELDLDGVNIDIENLTEKDRNLFTDFI
RLVRKSIPRHKEVSVAVAANPFGWTKGWHGSYDYEYLAKYADYLMVMAYDESRLAGPTAS
VGWVEKSIQYVLTQKISPQKLVLGLPFYGRCWMEGQSASQAIPLYLVVSKKA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaatgagctattactattctggattaggatgggactttattcaacacgttgat
caaacgaacggagtattaaatgttgtgtctcctgattttttctatatcagaaaagatgga
tcattacttctccgttcagctaatcccgatgtgattaaagctcttcatagaagaaaatta
aaagtagttccttttctaagcaatcattgggatcaggatttgggacgatttgcattaatg
aaccgagttcttttagctaaacaaatttctcatgcaatagaagaactggatttggatgga
gttaatatcgatatagaaaaccttacagaaaaagatcggaatctatttacagattttatt
agattagtaaggaaaagtattcctagacataaagaagtatcagttgcagtggcggcaaat
ccttttggctggacgaagggctggcacggatcatatgattacgagtatttagctaaatat
gcagattatcttatggttatggcctatgatgaaagccgccttgctgggcctactgcaagt
gtaggatgggtggaaaagtccattcaatatgttctgacccaaaaaatctctcctcaaaaa
ctagttttaggattgccattctatggccgctgctggatggaaggccaatctgcctctcaa
gccattcccctttaccttgttgttagtaaaaaggcatag

DBGET integrated database retrieval system