KEGG   Bacillus subtilis subsp. subtilis 168: BSU13799Help
Entry
BSU13799          CDS       T00010                                 

Gene name
ykzR
Definition
(RefSeq) spore-specific glycosyl hydrolase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 DUF2778
Motif
Other DBs
NCBI-GeneID: 8303134
NCBI-ProteinID: YP_003097720
UniProt: C0H404
Position
1446317..1446568
Genome map
AA seq 83 aa AA seqDB search
MLVKRHSGTIIFDTKSQSPKAIFTVNHDKKGPLPSGTYTLWFENEQSLRAKIKLAQKYNL
KGLGSWSLGQEDASVWNTVFKNI
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
ttgttagtaaaaaggcatagcgggacaattatttttgacaccaagagtcaatctccaaaa
gctatttttactgtcaatcacgataaaaaggggccgttgccttcgggaacatatacatta
tggtttgaaaatgaacagtcactcagagcaaaaataaaactcgctcaaaaatataatctg
aaaggtcttggcagctggagtcttggacaagaagatgcgtcagtctggaatacagtgttt
aaaaatatataa

DBGET integrated database retrieval system