KEGG   Bacillus subtilis subsp. subtilis 168: BSU13810Help
Entry
BSU13810          CDS       T00010                                 

Gene name
ykvS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2187 Pox_A30L_A26L YajC
Motif
Other DBs
NCBI-GeneID: 939299
NCBI-ProteinID: NP_389264
Pasteur: BG13321
BSORF: BG13321
UniProt: O31684
Position
complement(1447662..1447847)
Genome map
AA seq 61 aa AA seqDB search
MKIAKVGNVIEFKNGLTGVVEKVNENSVIVDVTIMDNYRDLELDSLTVVNHKNYKIIRDS
Y
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcgctaaggttgggaatgtcattgaatttaaaaacggattaaccggtgttgtt
gaaaaagtaaatgagaattctgttatcgttgatgtgacgatcatggataactatcgggat
cttgagttagattcattgacagttgttaatcataaaaattataagatcatcagagactcc
tattaa

DBGET integrated database retrieval system