KEGG   Bacillus subtilis subsp. subtilis 168: BSU13819Help
Entry
BSU13819          CDS       T00010                                 

Gene name
ykzS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8302968
NCBI-ProteinID: YP_003097721
UniProt: C0H405
Position
1448013..1448207
Genome map
AA seq 64 aa AA seqDB search
MRPEEITEMIEQLRTGAINELRVQKEHFLDFRAVLSKQDDFKHFRGIAQQGGDVIFQYLE
QPRS
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtcccgaagaaataacagaaatgattgaacagctgcgcaccggcgccataaacgaa
ctgagagtccagaaagagcattttcttgatttcagggccgtgttatctaaacaagatgat
tttaaacatttccgaggaattgcccagcaaggcggagatgttatctttcaatacttagaa
cagccaagaagctga

DBGET integrated database retrieval system