KEGG   Bacillus subtilis subsp. subtilis 168: BSU13820Help
Entry
BSU13820          CDS       T00010                                 

Gene name
ykvT
Definition
(RefSeq) hypothetical protein
  KO
K01449  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU13820 (ykvT)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     BSU13820 (ykvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_2 DUF3537
Motif
Other DBs
NCBI-GeneID: 939264
NCBI-ProteinID: NP_389265
Pasteur: BG13322
BSORF: BG13322
UniProt: O31685
Position
1448506..1449132
Genome map
AA seq 208 aa AA seqDB search
MTTKFTALAVFLLCFMPAAKIEHTQASLLSAKKTKHEEAKWLTHIDRNTNESFPSLSADK
DKKIKPIKLSAHTEKKEKDKPDKTNDEKETYTQSEKELLSRLVHAEAKGESYKGKVAVAS
VVLNRTEKKGFPDTIRGVIYQKNAFEPVANGSINQKPDKESIEAAEEALSSKNRETDAIF
FYNPKTASDNWIRSRKIVEKIGRHVFAV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgaaattcactgctctggctgtttttcttctttgtttcatgcctgcagccaaa
attgagcatacacaagcttcactactgagcgcaaagaagacaaaacatgaagaagcgaaa
tggcttacacatatagatcgaaatacgaatgaatctttcccttcactgtctgctgataaa
gacaagaaaataaaaccgattaagctatcagcacacactgaaaagaaagagaaagataaa
ccggacaaaacaaatgatgagaaagaaacatatacacagtctgaaaaagagttgctgtcc
cgtctcgttcacgcagaggccaaaggagaatcatataaaggcaaggtcgctgtagcaagc
gttgtactgaacaggacggagaaaaaaggttttcctgatacgataagaggagttatttat
cagaaaaacgcctttgaaccggtcgcaaacgggagcattaaccaaaagcctgataaagaa
tcgattgaagctgccgaagaagcgctgtcctcaaaaaatagagaaacagatgccatattc
ttttataatccgaaaacagcgtcagataattggattcgttcaagaaaaatcgtagaaaaa
atcggcagacacgtttttgccgtctaa

DBGET integrated database retrieval system