KEGG   Bacillus subtilis subsp. subtilis 168: BSU13830Help
Entry
BSU13830          CDS       T00010                                 

Gene name
ykvU
Definition
(RefSeq) sporulation protein YkvU
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt MatE Polysacc_synt_C PetG Phtf-FEM1B_bdg
Motif
Other DBs
NCBI-GeneID: 939262
NCBI-ProteinID: NP_389266
Pasteur: BG13323
BSORF: BG13323
UniProt: O31686
Position
1449250..1450587
Genome map
AA seq 445 aa AA seqDB search
MNRFVKGIILLSIAAFFAECLEFVVNMILARELGEHGMGLYMSILPTIFLIIVIASLELP
ISISKFIAESNPKLHESMLRHAFRMTAIFTAFSTAAASIALPFIPVFDTYHPFIKGIVIG
LIPVVAFTSIARGYFMGVQKMGKIAIANVLKKIIQLLCLFLFFQWYSFELDMAVLISLFV
LVVSDVVVLVYLYSQFIMARRALSGQQHIHLRGKDVRKRLLAVSIPTTGLRIFHAVVNAI
EPFLVKGALLAAGVAGTAAIDQYGMLAGVAVTIGSFPAFIAHSLMVVMIPSISEAYALSQ
YDIVLKRLKQSIFITLGYGIPAVWVMFQFAGPLTHLFFHSPEAQYYLQLLWPYFLFHLFV
MPLQACLIGMGFVKEAFYHNVWSHIVALSMMYVLGSMENLQMLGIILGMNTGMILLTSLH
YATICKALKVSVFLTGGTRTPRIEG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatttgtgaaagggatcattcttttatccattgccgcctttttcgctgaatgc
cttgaatttgtcgtcaatatgattttggcgcgggagcttggcgagcatgggatggggctt
tacatgagtattttgcccacgatctttttaattattgtcatcgcgagcctggaactgccg
atatccatttctaaattcattgccgagtcaaatcctaagcttcatgaaagcatgctgagg
cacgctttcagaatgacagccatttttactgctttttctactgccgccgctagtattgcg
cttccgtttattccggtatttgatacataccacccgtttattaaagggattgtcatcggc
ttaattcctgttgtcgcctttacttcaatcgccaggggctactttatgggtgtgcagaaa
atggggaagatcgcaattgccaatgtgctgaaaaaaatcatccagctcttgtgcttattc
ctcttttttcaatggtactcatttgaattggacatggctgtgctgatttccttgtttgtt
ctagtcgtgagtgatgtggtcgtgcttgtttatttatattcacaatttatcatggcaagg
cgggcgttatccggccagcagcacattcatttgcgcggaaaggatgtaaggaaaagactg
cttgctgtttcaattcctacaacaggactgcgtatttttcatgcggttgtcaatgcaatt
gaaccctttttagtaaaaggagctcttttggctgcgggcgttgccgggacagcggcgatc
gatcaatacggaatgctggcaggagtggctgtgacgatagggtcgttccctgcttttatt
gcccattcgttaatggtcgtcatgataccgagtatttcggaagcttatgcactttctcag
tatgacatcgtgttaaaaaggctgaagcagtcgattttcattacattaggttacggtata
cctgccgtctgggtcatgttccagtttgcgggacctctcacgcatttgttttttcactct
cctgaagcgcagtattacttgcagctgttgtggccttactttctctttcatctgtttgtc
atgccgctgcaggcgtgcttaatcgggatgggttttgtgaaagaggctttttatcacaat
gtatggagccatatcgttgcgctaagtatgatgtatgtactgggatcaatggagaatctg
caaatgctcgggattatccttggaatgaacactggcatgattcttttgacgagcctgcac
tatgccacgatctgcaaagcattgaaggtatctgtatttcttacgggagggaccagaacg
ccgcgaattgaaggatga

DBGET integrated database retrieval system