KEGG   Bacillus subtilis subsp. subtilis 168: BSU13840Help
Entry
BSU13840          CDS       T00010                                 

Gene name
stoA
Definition
(RefSeq) sporulation thiol-disulfide oxidoreductase A
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AhpC-TSA Redoxin Thioredoxin_8 Thioredoxin Thioredoxin_2 Thioredoxin_9 DUF953 QSOX_Trx1
Motif
Other DBs
NCBI-GeneID: 936262
NCBI-ProteinID: NP_389267
Pasteur: BG13324
BSORF: BG13324
UniProt: O31687
Structure
PDB: 

Position
1450638..1451135
Genome map
AA seq 165 aa AA seqDB search
MLTKRLLTIYIMLLGLIAWFPGAAQAEEKQPAVPAVFLMKTIEGEDISIPNKGQKTILHF
WTSWCPPCKKELPQFQSFYDAHPSDSVKLVTVNLVNSEQNQQVVEDFIKANKLTFPIVLD
SKGELMKEYHIITIPTSFLLNEKGEIEKTKIGPMTAEQLKEWTEE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaagcgcttgcttactatatacattatgttattagggttgattgcatggttt
ccaggtgcggcacaagctgaggaaaaacagcctgctgttcccgctgtttttcttatgaaa
acgatagaaggggaggacatctcgattccgaataaagggcaaaaaacaattctccatttt
tggacgtcatggtgcccgccctgcaaaaaggagcttccacagtttcaatcgttttatgat
gcccatccatccgacagtgtaaagctggtaacggtgaatttagtgaattcggaacaaaat
cagcaagtcgttgaagactttattaaagcaaacaagctgacgtttccgattgtccttgac
tcaaaaggggaattgatgaaggagtatcatatcatcacgatcccaacatcatttttgctg
aatgaaaagggagaaattgaaaaaacaaaaattggcccgatgacagcggaacaactgaag
gaatggacggaagaatag

DBGET integrated database retrieval system