KEGG   Bacillus subtilis subsp. subtilis 168: BSU13850Help
Entry
BSU13850          CDS       T00010                                 

Gene name
zosA
Definition
(RefSeq) zinc-transporting ATPase
  KO
K01534  Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 7.2.2.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU13850 (zosA)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     BSU13850 (zosA)
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.12  P-type Zn2+ transporter
     BSU13850 (zosA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 HAD Acetyltransf_10 HAD_2 CoA_binding_2 DUF4203
Motif
Other DBs
NCBI-GeneID: 939268
NCBI-ProteinID: NP_389268
Pasteur: BG13325
BSORF: BG13325
UniProt: O31688
Position
1451371..1453284
Genome map
AA seq 637 aa AA seqDB search
MNEQVIVQRDPHEPLKTDKREKNWAQHAELIAALVSGALILAGWLLSGYQVLSIILFLLA
FVIGGFAKAKEGIEETLESKTLNVELLMIFAAIGSALIGYWAEGAILIFIFSLSGALETY
TMNKSSRDLTSLMQLEPEEATLMVNGETKRVPVSDLQAGDMIVIKPGERVAADGIIESGS
TSLDESALTGESMPVEKNTGDTVFTGTVNRNGSLTVRVTKANEDSLFRKIIKLVESAQNS
VSPAQAFIERFENAYVKGVLIAVALLLFVPHFALGWSWSETFYRAMVFMVVASPCALVAS
IMPAALSLISNGARNGMLVKGSVFLEQLGSVQMIAFDKTGTVTKGQPAVETIRIAEGFSE
AEVLEAVYAIETQSSHPLAQAITAYAESRGVNQSGYISIEETSGFGVMAEVSGAKWKVGK
AGFIGEEMAAQFMKQTASDVIQSGHTIVFVKKDDQIAGCIALKDQIRPEAKEVMEELNRL
GIKTAMLTGDHEDTAQAIAKEAGMTTVVAECLPDQKVNEIKRLKEEFGTIAMVGDGINDA
PALKAADVGIAMGGGTDVALETADMVLMKNDLKKLVNMCRLSRKMNRIIKQNIVFSLAVI
CLLICANFLQAMELPFGVIGHEGSTILVILNGLRLLK
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaagttatcgttcaacgcgacccgcatgagccattgaaaacagacaagagg
gaaaaaaactgggcacagcacgcggagcttattgcagcacttgtatcaggcgctcttatt
ttggcaggctggctcttatccggatatcaggtattatccataatacttttcttgctggct
tttgtgatcggcggatttgctaaagcgaaggaaggaatcgaagaaacactcgaatccaaa
acgctgaatgtagaacttttaatgattttcgctgccattggttccgccttgatcggatac
tgggcagagggtgctattttaatatttattttttccttaagcggagctttagaaacatac
acgatgaataaaagcagcagagatttaacgtctttaatgcagcttgagcctgaagaagcg
acattgatggtcaatggtgaaaccaaaagagttccggtttcagacttgcaggccggtgat
atgattgtgatcaaacctggagaacgcgtagcggcagacggtatcattgaatcgggctcg
acaagtcttgacgagtcggctttaacaggtgaatcaatgcctgtagaaaaaaacacaggc
gacactgtattcacaggaacggtgaatcgcaatggctccttgacagtccgtgtcacgaaa
gcaaatgaagattcgttattcagaaaaattatcaaactggttgaatcagcgcaaaatagt
gtttcacccgcgcaggctttcatcgaacgatttgaaaatgcttatgtgaaaggtgtgcta
attgcggtggcgctccttttattcgtcccgcactttgcgctgggctggagctggagtgaa
accttctaccgcgcaatggtgtttatggttgtcgcgtcaccttgtgcgcttgtcgcctct
attatgccggcggcgctgtccctgatttcaaatggcgcccgcaacggtatgcttgtgaaa
ggaagcgtctttcttgaacagctgggctcagtgcaaatgatcgcctttgataaaaccgga
actgtaacaaaaggccagcctgccgtagagacgatcagaatagcagaaggattcagtgaa
gcggaagttcttgaggctgtctatgccatcgaaacgcaatcaagccatccgctcgcccaa
gccataacggcgtacgctgaaagccgcggcgtgaatcagtccggctacatatctatagaa
gaaacctcagggtttggcgttatggcagaagtgtcgggtgcgaaatggaaggtcggtaaa
gcaggttttatcggcgaggaaatggcagcacaatttatgaaacaaacagcatcagatgtc
attcaaagcggtcatacaattgtatttgtgaaaaaggatgatcaaatagcaggctgtatc
gcactgaaggaccaaatcaggcctgaagcaaaagaggtcatggaagaactgaaccgactt
gggattaaaacggccatgctgacaggagatcacgaagacacggctcaagcgattgccaag
gaagccggcatgacaactgtcgtggcagaatgcctgcctgaccaaaaagtgaatgaaatc
aaacggttaaaagaagaattcggaacgattgcaatggtgggtgacggaatcaatgatgcg
ccggcactcaaagcagcggatgtcggcattgcgatgggcggcggaacagatgtagcactt
gagaccgctgatatggtcctcatgaaaaacgatttgaaaaagctcgtaaacatgtgccgc
ttgtctcggaaaatgaacaggatcatcaaacaaaatatcgtgttttctctagctgtaatc
tgcctgctgatttgtgcaaactttttgcaggcgatggaattgccatttggcgtgattggt
catgagggcagcacgattttagtcatactaaacggtttaagactcctaaaataa

DBGET integrated database retrieval system