KEGG   Bacillus subtilis subsp. subtilis 168: BSU13860Help
Entry
BSU13860          CDS       T00010                                 

Gene name
ykvY
Definition
(RefSeq) dipeptidase YkvY
  KO
K01271  Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU13860 (ykvY)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     BSU13860 (ykvY)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M24
   BSU13860 (ykvY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24 Creatinase_N
Motif
Other DBs
NCBI-GeneID: 939258
NCBI-ProteinID: NP_389269
Pasteur: BG13326
BSORF: BG13326
UniProt: O31689
Position
1453691..1454782
Genome map
AA seq 363 aa AA seqDB search
MNRIQRVSSWLKEAGHTAAFIHTKENVFYLTGFYTEPHERLMGLFIFQEEEPFFVCPGME
AGQARNAGWNHEIIGYADHENPWELIEKALKKRNISIHMLAVEKDSISLSRAEQLKHATG
GAQFVSAEETLNQFRLIKDDNEIRLLKEAAKLADYGVEVGTAALREGISEVEVLAQIEYE
LKKKGIQGMSFSTMVLFGEKSGQPHGNPGTATLKKGDFVLFDLGVILDGYCSDITRTFAY
KTINPKQEAIYETVLQAEKAAIEASKPGVRIGDLDLTARGIIEKAGYGDYFPHRLGHGLG
ISVHEYPSMSQANDTLLQEGMVYTIEPGIYVPEIGGVRIEDDVHVTKDGAVALTQYPKDL
IIL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgaatagaatacaacgcgtctcttcatggctgaaggaagcggggcatactgccgcattt
attcatacgaaagaaaatgttttttacttaaccggtttttacacagagccgcatgaaaga
ttaatggggttatttatttttcaagaagaggagcctttctttgtttgtccaggaatggaa
gcaggacaggcccgcaacgcaggctggaatcatgaaatcattggctatgcggatcacgaa
aatccgtgggagctgatagagaaggctttgaaaaagcgaaatatcagcatacatatgctt
gcggtagaaaaggattcaatctcgctgtcacgtgcagaacagctgaagcatgcgacgggc
ggggctcaatttgtttcagcagaagaaacactcaatcaatttcgcctgattaaagatgac
aatgagattcgtttgctgaaagaggcggcaaagcttgcagattacggtgttgaagtcggc
acagccgctttgcgtgaaggcatcagtgaagtggaagtgctcgctcaaattgagtatgag
ctgaagaaaaaaggaattcagggcatgtctttctctacaatggttttattcggagaaaaa
tctggccagcctcatggaaatcctggtacagccacgttgaagaaaggtgattttgtttta
tttgatctcggtgttattcttgatggctattgctctgatattacaagaacgtttgcatac
aaaaccatcaatccgaagcaggaggccatttacgagactgtgcttcaagcggaaaaagcc
gcgattgaggcaagcaaacccggtgtgagaatcggagatctggatttaactgcccgcgga
atcattgaaaaagcgggatatggtgattattttcctcaccggcttgggcatggactcgga
atttcagtccatgagtatccatcaatgagccaggccaacgatacactgctgcaggaaggc
atggtctacacgatcgaaccggggatttatgtgccagagatcggcggcgtacgcattgag
gatgacgttcacgtaacaaaggacggagcagttgctctgacccaatatccaaaggatttg
atcatactgtaa

DBGET integrated database retrieval system