KEGG   Bacillus subtilis subsp. subtilis 168: BSU13870Help
Entry
BSU13870          CDS       T00010                                 

Gene name
ykvZ
Definition
(RefSeq) LacI family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_Tnp_ISL3 HTH_3 HTH_24 HTH_23 Trp_repressor HTH_38 HTH_10 MarR
Motif
Other DBs
NCBI-GeneID: 936232
NCBI-ProteinID: NP_389270
Pasteur: BG13327
BSORF: BG13327
UniProt: O31690
Position
1455064..1456029
Genome map
AA seq 321 aa AA seqDB search
MANIKDIAEKAGVSVTTVSRVINNHPYVSEDKRKRVFEAMESLEYTRNIHAVHLSKGFSN
MIGVVLPTVNLPYFAELIAGIADAAAESGVHLSLFQTNYEVQKEIFALSQLKQRQVDGLI
FCSKALADEKLMEWEGPILLCQNSDNARFPTISIPHQEAFRNGLDYLIAKGHKKIAICLA
RKKGMNSHFRIKAYKEALEEIGEAFREDWVIEKAITINDGKALFHKWNTWKEKPTAIFVA
NDQVSAGLFLEAKNQRVSVPDELAILSVDNHEISQALGITTIDIQTREMGKQAFAILEKR
IQGQPIERKVLDYRLIERSTV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctaatattaaagacattgcagagaaagccggtgtctctgttacaacggtttcccga
gtcataaacaatcatccatacgtcagtgaagacaaacgaaaaagagtgtttgaggcaatg
gaatcattggagtacacgagaaatattcacgctgtacatttgtcgaaaggattttcaaac
atgattggtgttgtcttgccgacggttaatctgccatattttgcagagctgattgcagga
atagccgacgcagccgcggaatccggggttcacctctctttattccaaacaaactatgaa
gtacaaaaagaaatctttgcgctgtcccaattaaagcagcgccaggttgacggcctgatt
ttttgctcaaaggcgcttgctgatgagaaactcatggaatgggagggcccgattttgctt
tgccagaattcagataatgcccgcttcccaaccatcagcattcctcaccaagaagcattt
cggaacggcttggactatttaattgccaaagggcacaaaaaaatagccatctgtttggca
agaaaaaaaggcatgaacagccattttcgaatcaaagcctacaaagaggcattggaagag
atcggcgaggcatttcgtgaagactgggtaattgagaaagcgattacaatcaatgatggg
aaggcgctttttcataaatggaatacgtggaaggaaaagccgacggctatttttgttgcc
aatgaccaagtctcagcagggctttttcttgaagcaaagaaccagcgggtgtcagtaccg
gatgagcttgcaatcttaagcgttgataaccacgaaatcagccaagcgcttggaatcaca
acgatcgatattcagacaagggaaatgggaaagcaggcatttgccatattggaaaaaaga
attcaaggacagccgattgaaaggaaagttctggattaccgtctcatcgaaagatcgact
gtttag

DBGET integrated database retrieval system