KEGG   Bacillus subtilis subsp. subtilis 168: BSU13880Help
Entry
BSU13880          CDS       T00010                                 

Gene name
glcT
Definition
(RefSeq) BglG family transcription antiterminator
  KO
K03480  transcriptional antiterminator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU13880 (glcT)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   BglG family
    BSU13880 (glcT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRD CAT_RBD
Motif
Other DBs
NCBI-GeneID: 939254
NCBI-ProteinID: NP_389271
Pasteur: BG12593
BSORF: BG12593
UniProt: O31691
Structure
PDB: 

Position
1456092..1456958
Genome map
AA seq 288 aa AA seqDB search
MTKELRIVNGSFTVKKVLNNNVLIASHHKYSEVVLIGKGIGFGKKQDDVIEDKGYDKMFI
LKDEKEQKQFKKLLDYVDEKLVDISNDVIYHISNRTNHSLNEHIHIALTDHIAFAIKRQQ
QGFDMKNPFLMETQSLYPEEYQIAKEVIDMINEKAGLCLPEGEIGFIALHIHSALTNRPL
SEVNQHSQLMAQLVEVIEDSFQMKVNKESVNYLRLIRHIRFTIERIKKEEPTKEPEKLML
LLKNEYPLCYNTAWKLIKILQQTLKKPVHEAEAVYLTLHLYRLTNKIS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggagctgaggatcgtgaatgggtccttcacagtgaaaaaggtactgaataat
aacgtattaattgcttctcatcataaatacagcgaagtcgttttaatcggaaaaggtatt
ggtttcggaaaaaaacaagatgatgtcattgaagataaaggctacgataaaatgttcatt
ttaaaagacgagaaggaacaaaagcagtttaaaaagctccttgactatgttgatgaaaag
ctcgttgatatttcaaacgatgtcatctatcacataagcaataggacgaatcactcatta
aatgaacatattcacattgcgttgacagaccatatcgcatttgcgatcaaaaggcagcag
cagggatttgatatgaaaaatccatttctaatggagactcagtcactatatcctgaggag
taccaaattgccaaagaagtcatagatatgatcaatgaaaaagcgggactctgccttccg
gaaggggagattggttttatcgctctgcatatccattcagcgttgacaaaccgtccgctg
tccgaggtcaatcagcactctcagctcatggcgcagcttgtcgaggtgattgaagactca
tttcaaatgaaagtaaataaggaaagtgtcaactatttgcggctgatcaggcatatcaga
tttacaatagaaagaattaaaaaagaagaaccgactaaagaaccagaaaaattaatgttg
ttattgaaaaatgaatatccgctatgctacaatacagcttggaaattgattaaaatcttg
cagcaaacattgaagaaaccagttcatgaggcggaagcggtttatctgacgcttcatctg
taccgattaaccaataaaatttcataa

DBGET integrated database retrieval system