KEGG   Bacillus subtilis subsp. subtilis 168: BSU13890Help
Entry
BSU13890          CDS       T00010                                 

Gene name
ptsG
Definition
(RefSeq) PTS system-glucose-specific transporter subunit EIICBA
  KO
K20116  PTS system, glucose-specific IIA component [EC:2.7.1.199]
K20117  PTS system, glucose-specific IIB component [EC:2.7.1.199]
K20118  PTS system, glucose-specific IIC component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00010  Glycolysis / Gluconeogenesis
bsu00520  Amino sugar and nucleotide sugar metabolism
bsu01100  Metabolic pathways
bsu02060  Phosphotransferase system (PTS)
Module
bsu_M00809  PTS system, glucose-specific II component
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSU13890 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    BSU13890 (ptsG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU13890 (ptsG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13890 (ptsG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     BSU13890 (ptsG)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component [MD:M00809]
    BSU13890 (ptsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIC PTS_EIIA_1 PTS_EIIB DUF5326 Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 939255
NCBI-ProteinID: NP_389272
Pasteur: BG10198
BSORF: BG10198
UniProt: P20166
Structure
PDB: 

Position
1457187..1459286
Genome map
AA seq 699 aa AA seqDB search
MFKALFGVLQKIGRALMLPVAILPAAGILLAIGNAMQNKDMIQVLHFLSNDNVQLVAGVM
ESAGQIVFDNLPLLFAVGVAIGLANGDGVAGIAAIIGYLVMNVSMSAVLLANGTIPSDSV
ERAKFFTENHPAYVNMLGIPTLATGVFGGIIVGVLAALLFNRFYTIELPQYLGFFAGKRF
VPIVTSISALILGLIMLVIWPPIQHGLNAFSTGLVEANPTLAAFIFGVIERSLIPFGLHH
IFYSPFWYEFFSYKSAAGEIIRGDQRIFMAQIKDGVQLTAGTFMTGKYPFMMFGLPAAAL
AIYHEAKPQNKKLVAGIMGSAALTSFLTGITEPLEFSFLFVAPVLFAIHCLFAGLSFMVM
QLLNVKIGMTFSGGLIDYFLFGILPNRTAWWLVIPVGLGLAVIYYFGFRFAIRKFNLKTP
GREDAAEETAAPGKTGEAGDLPYEILQAMGDQENIKHLDACITRLRVTVNDQKKVDKDRL
KQLGASGVLEVGNNIQAIFGPRSDGLKTQMQDIIAGRKPRPEPKTSAQEEVGQQVEEVIA
EPLQNEIGEEVFVSPITGEIHPITDVPDQVFSGKMMGDGFAILPSEGIVVSPVRGKILNV
FPTKHAIGLQSDGGREILIHFGIDTVSLKGEGFTSFVSEGDRVEPGQKLLEVDLDAVKPN
VPSLMTPIVFTNLAEGETVSIKASGSVNREQEDIVKIEK
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcattattcggcgttcttcaaaaaattgggcgtgcgcttatgcttccagtt
gcgatccttccggctgcgggtattttgcttgcgatcgggaatgcgatgcaaaataaggac
atgattcaggtcctgcatttcttgagcaatgacaatgttcagcttgtagcaggtgtgatg
gaaagtgctgggcagattgttttcgataaccttccgcttcttttcgcagtaggtgtagcc
atcgggcttgccaatggtgatggagttgcagggattgcagcaattatcggttatcttgta
atgaatgtatccatgagtgcggttcttcttgcaaacggaaccattccttcggattcagtt
gaaagagccaagttctttacggaaaaccatcctgcatatgtaaacatgcttggtatacct
accttggcgacaggggtgttcggcggtattatcgtcggtgtgttagctgcattattgttt
aacagattttacacaattgaactgccgcaataccttggtttctttgcgggtaaacgtttc
gttccaattgttacgtcaatttctgcactgattctgggtcttattatgttagtgatctgg
cctccaatccagcatggattgaatgccttttcaacaggattagtggaagcgaatccaacc
cttgctgcatttatcttcggggtgattgaacgttcgcttatcccattcggattgcaccat
attttctattcaccgttctggtatgaattcttcagctataagagtgcagcaggagaaatc
atccgcggggatcagcgtatctttatggcgcagattaaagacggcgtacagttaacggca
ggtacgttcatgacaggtaaatatccatttatgatgttcggtctgcctgctgcggcgctt
gccatttatcatgaagcaaaaccgcaaaacaaaaaactcgttgcaggtattatgggttca
gcggccttgacatctttcttaacggggatcacagagccattggaattttctttcttattc
gttgctccagtcctgtttgcgattcactgtttgtttgcgggactttcattcatggtcatg
cagctgttgaatgttaagattggtatgacattctccggcggtttaattgactacttccta
ttcggtattttaccaaaccggacggcatggtggcttgtcatccctgtcggcttagggtta
gcggtcatttactactttggattccgatttgccatccgcaaatttaatctgaaaacacct
ggacgcgaggatgctgcggaagaaacagcagcacctgggaaaacaggtgaagcaggagat
cttccttatgagattctgcaggcaatgggtgaccaggaaaacatcaaacaccttgatgct
tgtatcactcgtctgcgtgtgactgtaaacgatcagaaaaaggttgataaagaccgtctg
aaacagcttggcgcttccggagtgctggaagtcggcaacaacattcaggctattttcgga
ccgcgttctgacgggttaaaaacacaaatgcaagacattattgcgggacgcaagcctaga
cctgagccgaaaacatctgctcaagaggaagtaggccagcaggttgaggaagtgattgca
gaaccgctgcaaaatgaaatcggcgaggaagttttcgtttctccgattaccggggaaatt
cacccaattacggatgttcctgaccaagtcttctcagggaaaatgatgggtgacggtttt
gcgattctcccttctgaaggaattgtcgtatcaccggttcgcggaaaaattctcaatgtg
ttcccgacaaaacatgcgatcggcctgcaatccgacggcggaagagaaattttaatccac
tttggtattgataccgtcagcctgaagggcgaaggatttacgtctttcgtatcagaagga
gaccgcgttgagcctggacaaaaacttcttgaagttgatctggatgcagtcaaaccgaat
gtaccatctctcatgacaccgattgtatttacaaaccttgctgaaggagaaacagtcagc
attaaagcaagcggttcagtcaacagagaacaagaagatattgtgaagattgaaaaataa

DBGET integrated database retrieval system