KEGG   Bacillus subtilis subsp. subtilis 168: BSU13900Help
Entry
BSU13900          CDS       T00010                                 

Gene name
ptsH
Definition
(RefSeq) phosphocarrier protein HPr
  KO
K11189  phosphocarrier protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13900 (ptsH)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    BSU13900 (ptsH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS-HPr
Motif
Other DBs
NCBI-GeneID: 939259
NCBI-ProteinID: NP_389273
Pasteur: BG10200
BSORF: BG10200
UniProt: P08877
Structure
PDB: 

Position
1459384..1459650
Genome map
AA seq 88 aa AA seqDB search
MAQKTFKVTADSGIHARPATVLVQTASKYDADVNLEYNGKTVNLKSIMGVMSLGIAKGAE
ITISASGADENDALNALEETMKSEGLGE
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaaaaacatttaaagtaactgcagattctggaatccatgctcgtcctgcgaca
gttcttgtacaaactgctagcaaatacgacgctgacgttaatttagaatataacggcaaa
acagttaaccttaaatctattatgggtgttatgtctttaggtatcgctaaaggcgctgag
atcacaatctctgcttccggagctgacgaaaacgatgctcttaacgctttagaagaaaca
atgaaaagcgaaggactcggcgagtaa

DBGET integrated database retrieval system