KEGG   Bacillus subtilis subsp. subtilis 168: BSU13910Help
Entry
BSU13910          CDS       T00010                                 

Gene name
ptsI
Definition
(RefSeq) phosphoenolpyruvate-protein phosphotransferase
  KO
K08483  phosphotransferase system, enzyme I, PtsI [EC:2.7.3.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    BSU13910 (ptsI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU13910 (ptsI)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     BSU13910 (ptsI)
Transporters [BR:bsu02000]
 Phosphotransferase System (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    BSU13910 (ptsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers
Motif
Other DBs
NCBI-GeneID: 939253
NCBI-ProteinID: NP_389274
Pasteur: BG10201
BSORF: BG10201
UniProt: P08838
Position
1459650..1461362
Genome map
AA seq 570 aa AA seqDB search
MQELKGIGASAGIAIAKAYRLEEPDLTVEKKNISDSEAEVSRFDEAIARSKEELEKIKEH
ALKELGQDKADIFSAHLLVLSDPELLNPVKEKISTDSVNAEFALKETSSMFVTMFESMDN
EYMKERAADIRDVTKRVTGHLLGVEIPNPSMISEEVIIVAEDLTPSDTAQLNREFVKGFT
TDIGGRTSHSAIMARSLEIPAVVGTKAATGTIQNGVTVIVDGINGDVIIDPSAETVKEYE
EKHNAYLAQKAEWAKLVNEPTVSKDGHHVELAANIGTPDDVKGVLENGGEAVGLYRTEFL
YMGRDQLPTEDEQFDAYKTVLERMEGKSVVVRTLDIGGDKELPYLQLPKEMNPFLGYRAI
RLCLEEQEIFRTQLRALLRASTYGNLKIMFPMIATVNEFKEAKAILLEEKEKLVKAGQAV
SDDIEVGMMVEIPSTAVIADQFAKEVDFFSIGTNDLIQYTMAADRMNERVSYLYQPYNPA
ILRLITLVIEAAHKEGKWVGMCGEMAGDEIAIPILLGLGLDEFSMSATSILPARTQISKL
SKQEAESFKEKILSMSTTEEVVAFVKETFK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattaaaagggattggtgcttcagccggcatcgcgattgcaaaagcgtaccgg
cttgaagagccagatttaacggttgaaaagaaaaacatctctgattctgaagcggaagta
agccgttttgatgaagcgattgcacgttcaaaagaagagctcgaaaaaatcaaagagcac
gctttgaaagaactgggtcaggataaagctgatattttttctgctcaccttttagttctc
agtgaccctgagcttctgaaccctgtgaaagaaaaaatcagcactgattcagtgaacgct
gaattcgctttaaaagaaacgtcttctatgttcgttactatgtttgaatctatggacaac
gaatatatgaaagagcgtgcggcagatatccgcgatgtaacaaaacgcgtaaccggccac
ctgcttggcgtcgaaattccaaacccaagcatgatctcagaagaggttattattgtagct
gaagacttaacaccgtctgacacagctcaattaaaccgtgagttcgtaaaaggattcact
actgatatcggcggacgcacatctcactctgccatcatggcacgttctcttgagattcca
gcagttgttggaacgaaagctgctacaggcacgatccaaaacggcgtgactgttatcgtt
gacggtatcaatggcgatgtcattattgacccatctgcggaaactgtaaaagagtatgaa
gaaaaacataatgcttatttggctcaaaaagctgagtgggcgaagcttgtcaatgaaccg
actgtctcaaaagacggacatcatgtagagcttgcagcgaacatcggtactcctgatgat
gtaaaaggtgttcttgaaaacggcggagaagcagttggcctttaccgtacagaattcctt
tacatgggaagagatcagctgcctacagaagatgagcagtttgatgcttacaaaacggtt
cttgagcgtatggaaggaaaatcagtcgtcgtgcggacacttgatatcggcggagacaaa
gagcttccttacctgcagcttcctaaagaaatgaacccgttcctgggatatagagcgatt
cgtctttgccttgaagagcaagaaatcttcagaacacagcttcgcgcgctgcttcgtgca
agtacatacggaaacttgaaaatcatgttccctatgattgcgacagttaacgaattcaaa
gaagcaaaagcgatccttcttgaagagaaagaaaagctcgtaaaagcgggacaggctgta
tctgacgatattgaagtcggaatgatggttgagattccgtcaactgcagtcatcgctgat
cagtttgctaaagaggttgatttcttcagtatcggaacaaacgatttgattcaatacaca
atggcagctgaccgtatgaatgaacgtgtatcttacctgtatcagccatacaacccggca
atccttcgcttaattacactggtaattgaagcagcacacaaagaaggaaaatgggttggc
atgtgcggagaaatggcaggagacgagattgcgattccgatccttctcggcttaggctta
gatgagttctcaatgagcgcaacgtctatccttccggcaagaacacaaatcagcaaattg
tctaaacaagaagctgagtcattcaaagagaaaatcttatctatgagcacgacagaagaa
gttgtcgcgttcgtaaaagaaacattcaagtaa

DBGET integrated database retrieval system