KEGG   Bacillus subtilis subsp. subtilis 168: BSU13920Help
Entry
BSU13920          CDS       T00010                                 

Gene name
splA
Definition
(RefSeq) transcriptional regulator SplA
  KO
K06315  transcriptional regulator of the spore photoproduct lyase operon
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU13920 (splA)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU13920 (splA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SplA
Motif
Other DBs
NCBI-GeneID: 939728
NCBI-ProteinID: NP_389275
Pasteur: BG10202
BSORF: BG10202
UniProt: P37955
Position
1461453..1461692
Genome map
AA seq 79 aa AA seqDB search
MSNQFNAGDTVYVIYRNPHAANVAHIKEAEIVHHPYHEGELSLFIYETYHPFAEDDAVFA
SYEEAKSLYKELFDIDPYE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccaatttaacgcaggagatactgtttatgtgatctacagaaatccgcacgcc
gccaatgtagcccacataaaggaagccgaaattgtgcaccatccataccatgaaggcgag
ctttccctgtttatttatgaaacctatcatccattcgcagaggacgatgctgtgtttgca
agctatgaagaagctaaatcgctttacaaagaactgtttgatattgatccgtatgagtaa

DBGET integrated database retrieval system