KEGG   Bacillus subtilis subsp. subtilis 168: BSU13930Help
Entry
BSU13930          CDS       T00010                                 

Gene name
splB
Definition
(RefSeq) spore photoproduct lyase
  KO
K03716  spore photoproduct lyase [EC:4.1.99.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU13930 (splB)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.14  spore photoproduct lyase
     BSU13930 (splB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-GeneID: 939248
NCBI-ProteinID: NP_389276
Pasteur: BG10203
BSORF: BG10203
UniProt: P37956
Position
1461770..1462798
Genome map
AA seq 342 aa AA seqDB search
MQNPFVPQLVYIEPRALEYPLGQELQDKFENMGIEIRETTSHNQVRNIPGKNHLQQYRNA
KSTLVIGVRKTLKFDSSKPSAEYAIPFATGCMGHCHYCYLQTTMGSKPYIRTYVNVEEIL
DQADKYMKERAPEFTRFEASCTSDIVGIDHLTHTLKRAIEHFGQSDLGKLRFVTKFHHVD
HLLDAKHNGKTRFRFSINADYVIKNFEPGTSPLDKRIEAAVKVAKAGYPLGFIVAPIYIH
EGWEEGYRHLFEKLDAALPQDVRHDITFELIQHRFTKPAKRVIEKNYPKTKLELDEEKRR
YKWGRYGIGKYIYQKDEEHALREALESYIDTFFPNAKIEYFT
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacccatttgttccgcagcttgtgtatatagaaccgagggcgctggaatatccg
ctgggccaagaattacaagataaatttgagaatatgggtattgaaatcagagaaacgaca
tcccacaatcaggtgcgtaatatccctgggaaaaatcatcttcagcaatatcgcaatgcg
aaatcaactttagttatcggtgtccggaaaacattaaagtttgattcatccaaaccctcg
gccgaatatgccattccgtttgcaacaggctgcatggggcattgtcattactgctacctg
caaacaaccatgggatcaaagccgtatatcagaacttatgtaaacgtcgaagagatttta
gatcaggcagataagtatatgaaggagcgcgcaccagagttcacaaggttcgaagcatca
tgtacgtcagacattgtaggaattgatcatctgacacacacgctgaagcgcgccattgaa
cattttggccaaagtgatctcggaaagctccgatttgtaacgaaatttcatcatgtcgat
cacctattagacgcaaagcataacgggaaaacgagattcagattcagtattaatgccgac
tatgtgattaaaaactttgagccgggaacttcacctcttgataagcggatagaagcggca
gtaaaagttgcaaaagcaggctacccgctaggctttattgttgctccgatttatattcat
gaaggctgggaagaaggatacagacatctgtttgaaaagctagatgctgctttgccgcag
gacgttagacatgacattacgtttgaattaattcaacaccgttttacaaaaccggccaaa
cgagtgatagagaaaaattatccgaagacgaagctcgaattagatgaagaaaagcgccgt
tataaatggggccgttacgggatcggaaaatatatttatcagaaagatgaagagcatgca
cttcgagaggcacttgaatcctatattgatacctttttccctaacgcaaaaattgaatat
ttcacttaa

DBGET integrated database retrieval system