KEGG   Bacillus subtilis subsp. subtilis 168: BSU13940Help
Entry
BSU13940          CDS       T00010                                 

Gene name
ykwB
Definition
(RefSeq) N-acetyltransferase YkwB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_9 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-GeneID: 939246
NCBI-ProteinID: NP_389277
Pasteur: BG12252
BSORF: BG12252
UniProt: Q796K9
Position
complement(1462813..1463493)
Genome map
AA seq 226 aa AA seqDB search
MIILKQMYVHDGRKFEALTIRNYTETDIERLISLQEECFPPPFPQELLWSEDQLASHIKT
FPEGALCALINGRIIGSMTALIVQFEPDSPDHTWAQATDNGSIKNHEPHGNTLYVVDISV
SPHYRKLGIGKWLMNTMYELTVDKRLERLLGGGRIPLYYKYAHEISAVQYVEDVMEGRKN
DPVLSFLLRCGRSPIRVVSNYLEDKESLNYGVLMEWKNVFYKKASC
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatcatactaaaacaaatgtatgtgcatgacggcagaaaatttgaggctctgaccatt
agaaactacactgagactgacatcgagaggctgatttctcttcaagaagaatgtttccct
cctccgtttccccaggaattgctgtggtcagaggaccagcttgccagccatatcaaaacc
tttccggaaggcgctttatgcgcgctcatcaatggcagaattatcggttccatgactgct
cttattgtacaatttgagcctgattctcctgatcatacatgggcacaagcaactgacaac
ggatcgattaaaaatcatgaacctcatggaaatactttatatgtagtggatatttctgtt
tctcctcattatcgaaagcttggaatcggaaaatggctgatgaatacgatgtatgagctg
actgttgataaaagactggaacgccttctcggcggcggccgcattcctttgtattataaa
tacgcacacgagatcagcgctgttcagtacgttgaagatgtgatggaaggcaggaaaaac
gaccctgtgctgtcctttctcctccgttgcgggcgttcacctattcgtgtagtcagcaat
tatttggaggataaagaatcattgaattacggcgttttgatggaatggaaaaatgttttt
tataaaaaagcgagctgttga

DBGET integrated database retrieval system