KEGG   Bacillus subtilis subsp. subtilis 168: BSU13950Help
Entry
BSU13950          CDS       T00010                                 

Gene name
mcpC
Definition
(RefSeq) methyl-accepting chemotaxis protein McpC
  KO
K03406  methyl-accepting chemotaxis protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU13950 (mcpC)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU13950 (mcpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU13950 (mcpC)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    BSU13950 (mcpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP sCache_2 DUF948 CheZ
Motif
Other DBs
NCBI-GeneID: 936206
NCBI-ProteinID: NP_389278
Pasteur: BG11533
BSORF: BG11533
UniProt: P54576
Position
1463628..1465595
Genome map
AA seq 655 aa AA seqDB search
MFKKLHMKIAVFVSIMLIITVVLLMLSSYLTLKPMITEDGKNTTQNVTQSLEQNIELQLK
SYAISLSRLANGELTHTFVTKPSKEASRLFHDDIKQIKDNDDYVAMAYIGTAKKEMFTYP
KADFAEDYDPTSRPWYKLAAETPDQVVWTEPYKDVVTGDMIVTASKAILDRQKVIGVASY
DLKLSAIQSMVNKQKVPYKGFAFLADASGNLLAHPSNQGKNISKDQTLQTIASEKKGIQD
VNGKMVVYQTIGETGWKVGTQFDTDQLMWISDKMNRANLWISLIALIITIILSYFLAKTI
TGPIQQLIVKTKAVSAGDLTVRAESKSKDEVGILTRDFNLMVENMKEMVEQVRLSSGKVS
DTSEQLTAVAAETNETSGQIAKAIEEVAAGASEQASEVETINEKSESLSTKIRQIAEEAG
GIKERSKSSEDASYKGLDALGQLLMKSNEANMETKKVETMLLDLENQTKNIEEVVTAISN
ISDQTNLLALNASIEAARAGESGRGFAVVADEVRKLAEQSALSTKHISETVKLIQLETKE
ASHAMVEASRMNDEQNSAIHETGEVLNTITAEMQSLVQGIDHIYAEIQRMSEEQLAISEA
IQSISAISQESAAAAEEVNASTDEQLVTLDKVKHSTETLKHASQELMNTIAKFTL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaaaaaacttcacatgaagattgctgtttttgtttcgattatgttaatcatcaca
gttgttctcttaatgctgtcttcttatttgacgctaaaaccgatgattacagaggatggg
aaaaatacaactcaaaacgtgacgcagtcacttgaacaaaatattgaattgcaattaaag
agttatgccatttcgttatcaagattggctaatggggaattaacgcatacatttgtaacg
aaaccaagtaaagaagcttctcggctgtttcacgatgacattaagcaaatcaaagacaac
gatgattatgttgcgatggcttacataggcaccgcaaaaaaagaaatgtttacatatcca
aaagcggatttcgctgaggattacgatccaacatcaagaccatggtataagcttgcagct
gaaaccccggatcaagttgtttggacggaaccttataaagatgtcgtgacaggagacatg
attgttactgcatcgaaagcgatcttagacaggcaaaaagtgataggggttgccagctat
gacttgaaactctctgctatccagagtatggtcaataaacaaaaggtgccttacaaagga
tttgcctttttagctgatgcgagcggcaatcttttagcccatccgtcaaatcaaggaaaa
aatatatcaaaggatcaaacactgcaaaccatcgcatccgagaaaaaagggatacaagat
gtgaatgggaaaatggttgtgtaccaaacgattggcgagacaggctggaaggtcggaacg
caatttgataccgatcaattaatgtggatttcagataaaatgaatcgggccaatctttgg
atatcattgattgcgcttatcataacaattattctcagctacttcctggccaaaacgata
accggtccgatacagcagctgatcgtaaaaacgaaagctgtttccgcaggcgatttaaca
gtgcgcgcggaatcaaaatctaaggatgaagtcggtattttaacaagagatttcaatctg
atggttgaaaatatgaaggaaatggttgagcaagtgagactctcttcagggaaagtatct
gacacctctgaacaactaacggctgtggctgccgaaactaatgaaacaagcggacaaatt
gcaaaagcgattgaagaagtagccgcaggggcatcggaacaggcttctgaagttgaaacc
attaatgaaaaatcggaaagcctgtcaacgaaaatcaggcaaatcgctgaggaggcaggc
ggaattaaagaacgctcaaaatcgtccgaggatgcaagctataaaggacttgacgcgctc
ggccagctgctgatgaaatcaaacgaagccaatatggaaacgaaaaaggttgaaacgatg
ctgctggatttggaaaatcaaactaagaatattgaagaagtcgttacagcgatttcaaac
atatctgatcaaaccaacttgcttgccttaaatgccagtattgaggcagccagagccgga
gaaagcgggcgcggttttgccgtcgtagccgatgaagtgcggaagttagctgagcaatca
gccctttctacaaagcatatcagcgagactgtgaagcttatccagcttgagacaaaagag
gcctctcacgcgatggttgaggcaagcagaatgaatgatgaacaaaacagtgcaattcac
gaaactggagaggtattaaatacgataactgcagaaatgcagtcactggtacaaggtatt
gatcacatttacgcggaaattcaaagaatgagtgaagaacagcttgcgatttctgaagcc
attcaaagcatttcagccatatcacaggaatcagctgccgcagcagaggaagtgaacgca
tcaaccgatgaacagcttgtcacccttgataaagtcaaacactcaacggaaacactaaaa
catgcaagccaagagcttatgaacacaattgcaaaattcacattgtaa

DBGET integrated database retrieval system