KEGG   Bacillus subtilis subsp. subtilis 168: BSU13960Help
Entry
BSU13960          CDS       T00010                                 

Gene name
ykwC
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 3HCDH_N 2-Hacid_dh_C Shikimate_DH IlvN ApbA NAD_binding_7 PDH CbiK NAD_binding_10 NAD_Gly3P_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 939723
NCBI-ProteinID: NP_389279
Pasteur: BG13328
BSORF: BG13328
UniProt: O34948
Position
1465733..1466599
Genome map
AA seq 288 aa AA seqDB search
MKKTIGFIGLGVMGKSMASHILNDGHPVLVYTRTKEKAESILQKGAIWKDTVKDLSKEAD
VIITMVGYPSDVEEVYFGSNGIIENAKEGAYLIDMTTSKPSLAKKIAEAAKEKALFALDA
PVSGGDIGAQNGTLAIMVGGEKEAFEACMPIFSLMGENIQYQGPAGSGQHTKMCNQIAIA
AGMIGVAEAMAYAQKSGLEPENVLKSITTGAAGSWSLSNLAPRMLQGNFEPGFYVKHFIK
DMGIALEEAELMGEEMPGLSLAKSLYDKLAAQGEENSGTQSIYKLWVK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaacaattggttttatcggtcttggagtaatgggaaaaagcatggcatcacat
attctcaatgacggccatcctgtattggtgtacacccggacaaaagaaaaagcagaaagc
atacttcaaaaaggcgcgatctggaaagatacggtcaaagatctttcgaaagaagcggat
gttatcatcacaatggtcggctatcccagtgatgttgaagaagtgtatttcggaagcaat
ggaattattgaaaacgcaaaagaaggtgcatatcttattgatatgacgacatctaagcct
tcgcttgcgaagaagattgctgaagcggccaaagaaaaagcattgttcgctttagacgct
cctgtttccggtggagacatcggtgcacaaaacggaacactcgcgattatggtcggtgga
gaaaaagaagcttttgaagcctgcatgccgattttctctttaatgggagagaatattcag
tatcaaggaccggctggaagcggacagcataccaagatgtgcaatcagattgcaattgca
gccggtatgatcggtgttgctgaagcgatggcttatgcccaaaaatcaggcctagagccg
gaaaatgttctgaaaagcatcacaacgggcgcagccggaagctggtcattgtcaaatctt
gctccccgtatgctgcaaggcaactttgaaccgggattttatgtgaagcattttattaag
gatatgggaattgcactagaggaagcagaattaatgggggaagaaatgccaggcttgtcg
ctcgcaaaatctttatatgacaagctagctgctcaaggtgaagaaaacagcggaacacag
agtatatataagctttgggtgaaataa

DBGET integrated database retrieval system