KEGG   Bacillus subtilis subsp. subtilis 168: BSU13970Help
Entry
BSU13970          CDS       T00010                                 

Gene name
ykwD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CAP ABC2_membrane_3
Motif
Other DBs
NCBI-GeneID: 939237
NCBI-ProteinID: NP_389280
Pasteur: BG13329
BSORF: BG13329
UniProt: O31398
Position
complement(1466638..1467411)
Genome map
AA seq 257 aa AA seqDB search
MKKAFILSAAAAVGLFTFGGVQQASAKELSCQPVVTVKTGNTVQNMSLNDAVKKLHINTN
IKTLNAANEKEMKQLLQKHAKQSNVKVQDVQKTETAKPAQKTTEKAAADQNTASKAPATA
EKTNTTTSAPSSVSAYEKKVVELTNAERQKQGLKPLQIDETLSKSARAKSQDMKDKNYFD
HQSPTYGSPFDMMKSFGISYKTAGENIAKGQKTPEEVVKAWMNSEGHRKNILNPNFTHIG
VGYVESGSIWTQQFIGK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagcatttattttatctgctgccgctgcggttggattattcacattcgggggc
gtacagcaagcatcagcgaaagaactctcctgccagcctgtggttacagtaaaaacgggg
aacacagtacaaaacatgtcacttaacgatgcagtgaaaaaactgcatattaacacaaat
atcaaaacgttaaacgctgcaaacgaaaaagagatgaagcagcttcttcaaaaacatgcg
aagcaatctaacgtgaaagttcaggatgttcaaaagacagaaacggcaaaacctgcacaa
aagactactgaaaaagcagctgctgatcaaaacactgcttctaaagcacccgcaactgct
gaaaaaacaaacacaacaacgtctgcaccttcatctgtaagtgcatatgagaaaaaagtt
gttgaacttacaaatgcagaaagacaaaaacaaggcttaaaaccgcttcaaattgatgaa
acgttaagcaaatctgcacgcgcaaaatctcaggatatgaaagacaaaaactactttgat
caccaaagcccaacatacggctcaccgtttgatatgatgaaatctttcggaatcagctac
aaaacagcaggtgaaaacattgcgaagggccaaaagacaccagaagaagtagtaaaagct
tggatgaacagtgaaggacacagaaaaaacattctaaaccctaactttactcacatcggt
gttggttacgttgagtctggaagcatctggacacaacaattcatcggaaaataa

DBGET integrated database retrieval system