KEGG   Bacillus subtilis subsp. subtilis 168: BSU13980Help
Entry
BSU13980          CDS       T00010                                 

Gene name
pbpH
Definition
(RefSeq) penicillin-binding enzyme for formation of rod-shaped peptidoglycan cell wall
  KO
K21466  penicillin-binding protein H
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BSU13980 (pbpH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU13980 (pbpH)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BSU13980 (pbpH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-GeneID: 936204
NCBI-ProteinID: NP_389281
Pasteur: BG13286
BSORF: BG13286
UniProt: Q796K8
Position
1467805..1469862
Genome map
AA seq 685 aa AA seqDB search
MNLFFLAVFVLFTALIFKLGVVQIVEGEQHEEDAEKSNAKTAYYPAPRGKMYDRNQKVAV
DNQSVPEIVYVSTSSTKTEDKIKTAKRLASFIHIDTEFLKERDLRDYWIAAHPKKAAALL
KESESNLKGDQAYKLQIERVPDQELKAIQQDDEEMETAAIYTRFSSGNAYEPQIVKAMNP
NKSNSNGKNGALLDEKKNSSQRPKNDLTYDEISIVSEHLEELPGIDIVNDWTRKYPYDKT
LYSVFGGVTTPDQGLLSDRKDFYLTRGYANNDRVGKSYLEYQYEEYLNSHKEKVEYVEDN
KGNVVSQKTIDKGSRGYDLQLSFDMELQAKVEKIIEEEVRNSRARGNYMLDRAFAVMMDP
NNGDILSMAGKKIDLKTNKIEDYAIGAFTTQYEMGSAVKGATVLAGYQDGIPHYKYYIDA
PMLLGTNLIKKSYTNMGTINELTALQKSSNVYMFNVAMHIAGVTYKPHGSLPADQNDLLK
MRNYYSQFGLGVKTGIDLPQESAGMQTTPKTVGGLILDLAIGQYDTYTPLQMAQYISVIA
NGGYRVQPRIVTSIHKPGKKDQLGKAIEHRKPKVLNKINNSESDLKQVQTGMKLVTSSGT
AKNTFTEDVSGKTGTAETFYYGTNRNWWGKKTYNLTFVGYYPSKKPKVAFSVVVPSVDDD
DKINKIIAKRAIHAYAELEKKHSKK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaacctttttttcctagctgtctttgttctattcactgcattaatttttaagctcggg
gttgttcaaattgttgaaggcgaacagcatgaagaagacgctgagaaatcaaatgcaaaa
acagcttactatcctgcgcctcgcgggaagatgtacgacagaaaccagaaagttgctgtc
gacaaccagagcgttccagaaattgtgtatgtatcaacatctagcacaaaaacagaagat
aaaatcaaaacagcgaagcggcttgcttctttcattcatattgataccgaatttttgaag
gaaagggatcttcgtgattactggatcgcagctcatccgaaaaaagccgccgctctgctt
aaggaatcagaaagcaatctgaaaggagaccaggcttacaagcttcaaatagagcgtgtt
ccggatcaagaattaaaggctattcagcaagatgacgaagaaatggaaactgctgcgata
tatacaaggttttcaagcggaaatgcttacgaacctcaaatcgtaaaggcaatgaatcca
aataagagcaatagcaatggaaaaaacggagcgctgcttgatgagaagaaaaactcctcg
caaagaccaaaaaatgacttaacatatgatgaaatttccattgtttctgagcatttagaa
gaacttccgggaatcgatatcgtaaacgattggacacgaaaatatccttatgacaaaacc
ctttattctgttttcgggggcgtcacgacacctgatcagggcctgctgagcgaccggaaa
gatttctacttaacaagaggctatgcgaataatgacagggtgggaaaaagttatttagag
tatcaatatgaagaatatttaaattcgcataaagaaaaagtggaatacgtagaagataat
aaaggaaatgtcgtcagccaaaaaaccattgataagggcagcaggggatacgatcttcag
ctttcttttgacatggagcttcaggcaaaggtagaaaagatcattgaagaagaagtaaga
aacagccgtgcacgcggaaattacatgcttgacagagcctttgccgtaatgatggacccg
aataacggcgatattttatcaatggcagggaaaaagatagatttaaaaaccaacaaaatt
gaagattatgcgataggggcatttaccacccaatatgaaatgggatcagcagtaaagggg
gccaccgtgctagccggctatcaggacgggatcccgcattataaatattatatcgatgct
ccaatgcttttaggaacgaatcttataaaaaaatcttatactaatatgggaaccatcaat
gaattaaccgcattgcaaaaaagttcaaacgtatatatgttcaatgttgccatgcatatt
gcaggcgtaacatacaagccgcatggatctctcccggctgatcagaacgatctactgaaa
atgagaaactattacagccagtttggtctgggagtaaagacaggtattgatctcccgcag
gaatcagccggaatgcaaaccacacctaaaactgtaggaggattaattttagacttagca
attggccaatacgatacatacacaccgcttcaaatggctcaatacatctcagtaatcgcc
aatggtggctatcgtgttcagcctagaatcgtcacaagtattcataagccaggaaaaaaa
gaccagctgggtaaggcgattgaacataggaaacctaaagtactcaataagattaataat
tcagagagcgatttgaaacaagtacaaacaggcatgaaattagtcacttcttcagggaca
gcaaaaaatacgtttacagaagatgtatcagggaaaacgggaacagcggaaacattttac
tacggcacgaatcgcaactggtgggggaaaaaaacatacaatctgacttttgtcggctat
tacccgtcgaaaaaaccaaaagtggcctttagtgttgttgttccatcagtagatgatgat
gataagatcaataaaattattgccaaaagagctatccacgcctacgcagagctcgaaaaa
aaacacagtaaaaaataa

DBGET integrated database retrieval system