KEGG   Bacillus subtilis subsp. subtilis 168: BSU14000Help
Entry
BSU14000          CDS       T00010                                 

Gene name
patA
Definition
(RefSeq) N-acetyl-LL-diaminopimelate aminotransferase
  KO
K00841  aminotransferase [EC:2.6.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU14000 (patA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU14000 (patA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     BSU14000 (patA)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class I
   BSU14000 (patA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Alliinase_C OKR_DC_1 Aminotran_MocR
Motif
Other DBs
NCBI-GeneID: 939235
NCBI-ProteinID: NP_389283
Pasteur: BG10205
BSORF: BG10205
UniProt: P16524
Position
complement(1471857..1473038)
Genome map
AA seq 393 aa AA seqDB search
MEHLLNPKAREIEISGIRKFSNLVAQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTS
YTPNAGYLELRQAVQLYMKKKADFNYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPG
PIYPGYEPIINLCGAKPVIVDTTSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSE
EELKSIAALLKGRNVFVLSDEIYSELTYDRPHYSIATYLRDQTIVINGLSKSHSMTGWRI
GFLFAPKDIAKHILKVHQYNVSCASSISQKAALEAVTNGFDDALIMREQYKKRLDYVYDR
LVSMGLDVVKPSGAFYIFPSIKSFGMTSFDFSMALLEDAGVALVPGSSFSTYGEGYVRLS
FACSMDTLREGLDRLELFVLKKREAMQTINNGV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaacatttgctgaatccgaaagcaagagagatcgaaatttcaggaatacgcaaattc
tcgaatcttgtagcccaacacgaagacgtcatttcacttacaatcggccagcctgatttt
ttcacaccgcatcatgtgaaagctgccgcaaaaaaagccattgatgaaaacgtgacgtca
tatactccgaatgccggctacctggagctgagacaagctgtgcagctttatatgaagaaa
aaagcggatttcaactatgatgctgaatctgaaattatcatcacaacaggcgcaagccaa
gccattgatgctgcattccggacgattttatctcccggtgatgaagtcattatgccaggg
cctatttatccgggctatgaacctattatcaatttgtgcggggccaagcctgtcattgtt
gatactacgtcacacggctttaagcttaccgcccggctgattgaagatgctctgacaccc
aacaccaagtgtgtcgtgcttccttatccgtcaaaccctaccggcgtgactttatctgaa
gaagaactgaaaagcatcgcagctctcttaaaaggcagaaatgtcttcgtattgtctgat
gaaatatacagtgaattaacatatgacagaccgcattactccatcgcaacctatttgcgg
gatcaaacgattgtcattaacgggttgtcaaaatcacacagcatgaccggttggagaatt
ggatttttatttgcaccgaaagacattgcaaagcacattttaaaggttcatcaatacaat
gtgtcgtgcgcctcatccatttctcaaaaagccgcgcttgaagctgtcacaaacggcttt
gacgatgcattgattatgagagaacaatacaaaaaacgtctggactatgtttatgaccgt
cttgtttccatgggacttgacgtagttaaaccgtccggtgcgttttatatcttcccttct
attaaatcatttggaatgacttcatttgattttagtatggctcttttggaagacgctggc
gtggcactcgtgccgggcagctcgttctcaacatatggtgaaggatatgtaaggctgtct
tttgcatgctcaatggacacgctgagagaaggcctagaccgtttagaattatttgtatta
aaaaaacgtgaagcaatgcagacgataaacaacggcgtttaa

DBGET integrated database retrieval system