KEGG   Bacillus subtilis subsp. subtilis 168: BSU14009Help
Entry
BSU14009          CDS       T00010                                 

Gene name
ykzT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303007
NCBI-ProteinID: YP_003097722
UniProt: C0H406
Position
complement(1473240..1473401)
Genome map
AA seq 53 aa AA seqDB search
MGTLVIFKENEMTVLEDISEETYLNMKKESADLQEEHPPYLIWHEDLHFDYGY
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
atgggtaccttagtaatatttaaagaaaacgaaatgactgttttagaggatatcagtgaa
gaaacttacctgaatatgaagaaagaatcagctgaccttcaagaagagcatcctccgtat
ctgatttggcacgaagaccttcattttgattatggctattaa

DBGET integrated database retrieval system