KEGG   Bacillus subtilis subsp. subtilis 168: BSU14010Help
Entry
BSU14010          CDS       T00010                                 

Gene name
cheV
Definition
(RefSeq) chemotaxis protein CheV
  KO
K03415  two-component system, chemotaxis family, chemotaxis protein CheV
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
bsu02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU14010 (cheV)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    BSU14010 (cheV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU14010 (cheV)
   02035 Bacterial motility proteins [BR:bsu02035]
    BSU14010 (cheV)
Two-component system [BR:bsu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BSU14010 (cheV)
Bacterial motility proteins [BR:bsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BSU14010 (cheV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW Response_reg
Motif
Other DBs
NCBI-GeneID: 939239
NCBI-ProteinID: NP_389284
Pasteur: BG10823
BSORF: BG10823
UniProt: P37599
Position
1473605..1474516
Genome map
AA seq 303 aa AA seqDB search
MSLQQYEILLDSGTNELEIVKFGVGENAFGINVMKVREIIQPVEVTSVPHSHQHVEGMIK
LRGEILPVISLFSFFGVEPEGSKDEKYIVTEFNKRKIVFHVGSVSQIHRVSWEAIEKPTS
LNQGMERHLTGIIKLEDLMIFLPDYEKIIYDIESDSGVDTYNMHTEGFDERRTDKKLIIV
EDSPLLMRLLQDELKEAGYNNIASFENGKEAYEYIMNLAENETDLSKQIDMIITDIEMPK
MDGHRLTKLLKENPKSSDVPVMIFSSLITDDLRHRGEVVGADEQISKPEISDLIKKVDTY
VIE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgttacaacaatacgaaattttattggattctggtacaaatgaattagaaattgtg
aagtttggcgtgggtgaaaatgctttcggaattaacgtcatgaaggtaagagaaattatt
cagcctgtcgaggtgacatcagtgcctcactcccatcagcatgtagaaggaatgattaaa
ctcagaggagaaatcctccctgtgatcagtctcttctcattttttggagtagagcctgaa
ggatcaaaagatgagaaatatatcgtgactgaatttaataaacggaaaattgtttttcat
gtcggctctgtttctcaaattcacagagtatcctgggaagcgattgaaaagccgacatcg
ttaaatcaaggaatggagcggcaccttaccggtattattaagctcgaagacctgatgatc
tttttgcctgactatgaaaaaattatttatgacattgaatcagattcaggtgttgacacg
tataatatgcataccgagggcttcgatgaaagaagaactgataaaaagcttatcattgta
gaggactcaccgcttttgatgcgcctcttgcaggatgaattaaaagaagcagggtacaac
aatatcgcttcgtttgaaaatggaaaagaggcatatgaatacattatgaaccttgctgaa
aacgaaactgatttatcaaaacagattgatatgatcatcactgatattgaaatgccaaaa
atggacggacacaggctcacaaagctgctgaaggaaaatccgaaaagctcagatgtgccg
gttatgattttctcatcgttaattacggatgatctgcgtcaccgcggcgaagttgtaggc
gcagatgagcaaatcagcaagcctgagatcagtgatttgattaaaaaagtggatacgtat
gttattgaataa

DBGET integrated database retrieval system