KEGG   Bacillus subtilis subsp. subtilis 168: BSU14020Help
Entry
BSU14020          CDS       T00010                                 

Gene name
ykyB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkyB
Motif
Other DBs
NCBI-GeneID: 939225
NCBI-ProteinID: NP_389285
Pasteur: BG11202
BSORF: BG11202
UniProt: P42430
Position
complement(1474560..1475024)
Genome map
AA seq 154 aa AA seqDB search
MDDHAYTKDLQPTVENLSKAVYTVNRHAKTAPNPKYLYLLKKRALQKLVKEGKGKKIGLH
FSKNPRFSQQQSDVLISIGDYYFHMPPTKEDFEHLPHLGTLNQSYRNPKAQMSLTKAKHL
LQEYVGMKEKPLVPNRQQPAYHKPVFKKLGESYF
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggacgaccatgcatatacgaaagatctgcagccaaccgtagaaaatctttcaaaagca
gtttacactgtgaaccgccatgcaaaaaccgcccccaaccctaaatacctatatctgctg
aaaaaacgggctttgcaaaagcttgtcaaagaaggtaaaggaaagaaaatagggcttcat
ttttcaaaaaatccaaggttcagccaacagcaatcggacgtgcttatctcaatcggagac
tactattttcacatgcctccaactaaagaagacttcgaacatcttccgcatttaggtaca
cttaatcaatcgtatcgaaatcctaaagctcaaatgtctttaacaaaagcgaaacaccta
ttgcaagaatatgtcggcatgaaagaaaagccgctagtgccaaatcgccagcagccagct
taccataaaccggtctttaaaaaacttggcgagagttacttttaa

DBGET integrated database retrieval system