KEGG   Bacillus subtilis subsp. subtilis 168: BSU14030Help
Entry
BSU14030          CDS       T00010                                 

Gene name
ykuC
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 Meckelin
Motif
Other DBs
NCBI-GeneID: 939224
NCBI-ProteinID: NP_389286
Pasteur: BG13287
BSORF: BG13287
UniProt: O31695
Position
complement(1475150..1476442)
Genome map
AA seq 430 aa AA seqDB search
MDIFKNRNFVRLFFAALASQMGTTVGNMAFAFFLLDRFSSQPSYTTLAELMYSLPTIFVF
LIVGVVADRFDRKKVAENCDWIRAGLTVVLFFTLFTGNIPLVFCILFIRSAVTKFFFPAE
NSLVQAILPKEHYAKAAGLNQMLFSIFMVFGVGIGAFMYNTIGIEGAIILDFVSFIISGL
LIRSCRIPKEARQPNGAFSWRKTSVKDSINDFREGILYILKNKLLASLIFGFFIFGFVNG
GFAVLPMFTMKYGLAPDRYEWHTSVFTIALGFGLLAGSVIGTLISKKVKPHFLMSIPIFI
AGLLIFVLGYTNILWVYYAAAFALGMCIGPINIAIGGWMPKIVHPKLMGRVSGMQDPFMM
FAQSLTLGLVALLFPKFVSNIDYLYYGMGVIILLVFIFYFIALPKYSAQAVEVNVQEAFQ
EQPKKKARSV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatatatttaaaaatcgtaattttgttcgtctatttttcgcagcactcgcttctcaa
atgggcacgacagtaggcaacatggcctttgctttttttttgctggaccgattcagcagc
cagccttcatatacgaccttggcggagctgatgtattctcttccgaccatatttgtattt
ctgatcgtgggagtcgtcgcggaccggtttgatagaaaaaaggtggcagaaaattgtgat
tggatcagagcaggcctgactgtcgtgctttttttcactttatttaccggcaatattcct
cttgttttttgtatcttatttatcagaagcgctgtaacaaagtttttctttccggcagaa
aacagtttggtacaagccattctgccgaaggagcattatgcgaaagcggcagggcttaat
cagatgctttttagcatttttatggtgtttggagtcggcataggcgcgtttatgtacaac
acaatcggtattgaaggcgccattattcttgattttgtcagctttatcatttccgggctg
ctgatccgcagctgccggattccaaaagaagcccgacagccaaacggtgcattcagctgg
agaaagacttctgttaaggattcaataaatgactttagagaaggcatcctctatatttta
aaaaacaaattgctggcatctcttatttttggcttcttcatttttggatttgtcaatgga
ggattcgccgtattgccgatgtttacaatgaaatatggattggcgcctgaccgttatgag
tggcatacgtctgtatttacgatcgcactcgggtttgggcttctggcaggaagcgtaatc
ggcacgctcatctctaaaaaagtgaagccgcactttttaatgtcgataccgattttcatt
gcaggtttgctgatcttcgtcctcggctacaccaatattttatgggtgtattacgcggca
gcttttgcactgggaatgtgtatcggaccgatcaacattgcaatcggagggtggatgcca
aaaattgttcatccaaaactgatgggacgtgtaagcggcatgcaggacccttttatgatg
tttgcacaatctttgacactcggcttagtcgcgctgttattccctaagtttgtttcaaac
attgattatctttattacggcatgggtgttattatcctgctcgtttttattttttatttt
attgcactgccaaaatacagtgctcaggctgtggaagtgaatgttcaggaagcatttcaa
gaacagccgaaaaagaaggcaagatctgtataa

DBGET integrated database retrieval system