KEGG   Bacillus subtilis subsp. subtilis 168: BSU14040Help
Entry
BSU14040          CDS       T00010                                 

Gene name
ykuD
Definition
(RefSeq) L,D-transpeptidase YkuD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuD LysM Phage_tail_X Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 939216
NCBI-ProteinID: NP_389287
Pasteur: BG13288
BSORF: BG13288
UniProt: O34816
Structure
PDB: 

Position
complement(1476518..1477012)
Genome map
AA seq 164 aa AA seqDB search
MLTYQVKQGDTLNSIAADFRISTAALLQANPSLQAGLTAGQSIVIPGLPDPYTIPYHIAV
SIGAKTLTLSLNNRVMKTYPIAVGKILTQTPTGEFYIINRQRNPGGPFGAYWLSLSKQHY
GIHGTNNPASIGKAVSKGCIRMHNKDVIELASIVPNGTRVTINR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
ctgcttacgtaccaggtgaagcaaggtgatacactgaacagcatcgcggctgatttcaga
atcagcacggctgcattactccaggctaatccgtcactgcaggcagggctcaccgcggga
cagtccatagtcatccccggactgccggacccttatacaattccgtatcatatcgcagtc
tcaatcggagcgaagacccttacgctgtccctaaataatcgggtaatgaaaacctatccc
atcgccgttggtaaaatactaacgcaaacgcctactggcgagttttacattattaaccgc
cagcgcaatcccggcggcccatttggcgcttattggctgagcctttcaaagcagcactac
ggaatacatgggacgaataatcccgcttcgattggtaaggctgtttctaaaggctgcatt
cgcatgcataacaaagacgtgatcgaacttgcttcaattgtgccaaacggaacgagagtc
acgattaaccggtaa

DBGET integrated database retrieval system