KEGG   Bacillus subtilis subsp. subtilis 168: BSU14050Help
Entry
BSU14050          CDS       T00010                                 

Gene name
ykuE
Definition
(RefSeq) metallophosphoesterase
  KO
K07098  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU14050 (ykuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2 TAT_signal DNA_pol_E_B CytB6-F_Fe-S Metallophos_3 Gln-synt_N
Motif
Other DBs
NCBI-GeneID: 939214
NCBI-ProteinID: NP_389288
Pasteur: BG13289
BSORF: BG13289
UniProt: O34870
Position
complement(1477069..1477929)
Genome map
AA seq 286 aa AA seqDB search
MKKMSRRQFLKGMFGALAAGALTAGGGYGYARYLEPHMIETTEHTIKSSLIPHGFDGFKI
VQFSDAHLSDYFTLEDLKTVILTINESKPDLIVFTGDIIDNPDTYQHHQAVIPLLRKLNA
PFGKLCIYGNHDHGGYGTAVYKSLMTAGGFTVYRNGYQTLSLADGSKIEIASLDDLMLGN
PDYEGTLSRLSDRLFSILLVHEPDAALKTTDYPVNLQLSGHTHGGQIQLPFYGPIITPPY
GKVYTEGMYQTGSTHIYVNRGLGMTRLPLRFLAKPEITVFTLKSTN
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatgtccagaagacaatttctaaaaggaatgttcggcgctcttgctgccggg
gctttaacggccggcgggggatatggctatgccaggtatctcgagccgcatatgatcgag
acaaccgaacacacaataaaaagctctctcatcccgcacggatttgacggttttaaaatc
gtgcagttcagcgatgcacacttgagtgattactttactctcgaagatttaaaaactgtc
attcttacaattaatgaatctaaacctgatctcattgtttttacaggtgatattattgat
aatcctgatacgtaccagcaccaccaggcagtcattccattattgagaaagcttaatgct
cccttcggcaagctttgtatttacggcaatcatgatcacggaggctatggaactgccgtt
tacaaaagcctgatgacggccggaggtttcacggtatatcgcaatggctatcaaacattg
tcactcgcagatggcagcaaaatcgagattgcttcgcttgatgacttaatgctgggaaac
ccagattatgaaggcaccctttcaaggctgagcgacagacttttttccattcttctcgtc
catgaacctgatgcagccttgaaaacaacagattatcccgtgaaccttcagctttccggc
catacacacggcggccagattcagctgcctttttacggaccgattattacgcctccatat
ggaaaagtctacacagagggaatgtatcaaacgggcagcactcatatttacgtaaaccga
ggcctcgggatgaccaggctgcctttgcggtttcttgccaagcctgaaatcactgtcttc
accttaaaaagcacaaattaa

DBGET integrated database retrieval system