KEGG   Bacillus subtilis subsp. subtilis 168: BSU14060Help
Entry
BSU14060          CDS       T00010                                 

Gene name
ykuF
Definition
(RefSeq) 2,4-dienoyl-CoA reductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_2 Epimerase 3HCDH_N DFP MbtH ATP_bind_2
Motif
Other DBs
NCBI-GeneID: 939226
NCBI-ProteinID: NP_389289
Pasteur: BG13290
BSORF: BG13290
UniProt: O34717
Position
1478072..1478836
Genome map
AA seq 254 aa AA seqDB search
MEKKAVIITGGSSGMGKAMAKKQAELGWHVMVTGRNHEALEETKKEIQTFEGQVACFQMD
VRSDSAASDMIKEAVKAFGRLDALINNAAGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQ
AAARHWIDQKQQGVILNMAATYAWGAGAGVVHSAAAKAGVLSLTRTLAVEWGSKYGIRTN
AIAPGPIERTGGAEKLFESEKAMARTMNSVPLGRLGTPEEIAALAAFLLSDEASYINGDC
ITMDGGQWLNPYPF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaggcggtaattattaccggcgggtcaagcggcatgggaaaagcgatggca
aaaaaacaggctgaattagggtggcacgttatggtgacagggaggaaccatgaggcactt
gaggaaacaaaaaaagaaattcagacctttgagggacaggtcgcttgttttcaaatggat
gtccgttccgattccgccgcttcagacatgattaaagaagcggtaaaagcctttggccgg
cttgacgcgctgattaacaacgcggccggaaactttatttgtccggcagaaaagctgacg
cccaatggatggaaagccgttattgagattgttttaaacggcacatttttttgcagccaa
gcagcggcaaggcattggattgaccagaagcagcagggtgtcattttaaatatggcagcc
acgtacgcttggggagcgggagcgggggtcgttcattccgctgcagccaaagcgggggta
ttgtcattgacaagaacgctggccgttgaatgggggagcaaatacggcattcgtacaaac
gcgatagcccccggaccgattgaacgaacaggcggtgcggagaagctatttgaatcggaa
aaagcgatggcccgcacgatgaacagtgtgccgctcggccgattgggcacaccggaggaa
atcgccgctttggcagcgtttttgctttctgatgaagcatcctatataaacggggattgt
atcacaatggacggggggcaatggctgaatccttatccgttttaa

DBGET integrated database retrieval system