KEGG   Bacillus subtilis subsp. subtilis 168: BSU14071Help
Entry
BSU14071          CDS       T00010                                 

Gene name
fadG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1906 PG_binding_1
Motif
Other DBs
NCBI-GeneID: 8303034
NCBI-ProteinID: YP_003097723
UniProt: O34320
Position
1479137..1480867
Genome map
AA seq 576 aa AA seqDB search
MDEMVLLTQEWLNETYKGKSGYNSIEENGKTGWKTMYALTRALQLELGITQTSDSFGPTT
LRKLKELGPISTSTNSKKNIVKIIQGALYCKGYGPGGLTGTFGQGTKEAIAEMQLHMGLS
KTDGVVTPKVFKALLNMDSYILLNGASEKVRSIQQWLNNKYYNRENFYFMPCDGLYSRDT
QKSLVYAIQYEEGLSDSIANGNFGPTTQRLIPVLRIGETDEKNSFIHLFQAALIFNGYNV
PFDGVYSESVRSKVKAFQSFAKLQQSGTADFQTWASLLVSTGDPNRKGVACDSITQITSD
RAESLKRAGYKIVGRYLTNAPGSTLNKKIQPGELETILKSGLNVFPIYQTYGGATNYFNK
EQGKKDAFAAYKAAKEYGFKNNTVIYFAVDYDAYGNDLNNNIIPHFEGINEIMNGFLGST
YKIGIYAPRNVCTIVSKKGLAFASFVSGMSTGFSGNLGYPLPYNWAFDQISTITVGNGSG
MIEIDNDICSGLDNGVNTINIVPSENKKFFDQIDVLYETAEKYAQMQSDLNNGVKKTQLA
NELVAQYLRKDDYKGWKWVPTAGQIDPIYREWAVKR
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggacgagatggtattattaactcaggaatggctcaatgaaacgtacaaaggaaaaagt
ggctacaattccattgaggaaaatgggaaaactggctggaaaacaatgtatgcattaact
agagcattacaactagaattgggaattacacagacttccgacagttttggtcctacaact
ttaagaaagcttaaagaattaggcccgatttctacgtcaactaattcaaaaaaaaatatt
gtgaaaattattcaaggtgctctttattgtaaaggttatggtccaggtggattaacgggt
acatttggtcagggaacgaaagaggcgatagcagaaatgcaattgcatatggggctttct
aaaacagacggtgtagtaacgcctaaggtgtttaaagctttattaaacatggactcttat
atccttttaaatggggcgtcagagaaagttcgttcaatacagcaatggctaaataataaa
tattacaatagagagaatttctactttatgccctgtgatggcctgtattcaagggatact
caaaagtctcttgtttatgcaatacagtacgaggaagggttaagtgatagtatagctaat
gggaattttggaccaactactcaaagattgattcctgtattaagaattggagaaacagat
gaaaaaaacagttttattcatttatttcaagctgctctaatctttaatggctacaatgtt
ccttttgatggagtatactctgaatctgtaagatcaaaagtaaaggcttttcagtctttt
gcaaaattacaacagagtggtactgccgactttcaaacatgggcttcacttctagtaagt
actggagaccccaatcgaaaaggagttgcttgtgactcaattactcaaattacatcggac
agggcggagtcccttaagagggcaggttataagattgtagggcggtatctaacaaatgcg
ccggggagtacactaaataaaaaaatacaaccaggtgaattagaaactatcttaaaatca
ggtttaaatgtttttccgatttatcaaacctatgggggagcaacaaattattttaataaa
gaacaaggaaagaaagatgcgtttgctgcttataaagcagcaaaagaatacgggtttaaa
aataacactgtaatatactttgcagtagattatgatgcatatggtaacgatttaaacaac
aatattattccacacttcgaaggtataaatgaaataatgaacggttttttaggttcaact
tacaaaattggtatttatgcccctaggaatgtatgtactatagtttctaaaaaaggttta
gcatttgcaagttttgtaagtggtatgtctactggctttagcggaaacttaggatatcct
ttgccttacaattgggcgtttgaccaaatttcaacaattactgttggaaatggttctgga
atgattgaaattgataatgatatttgttcaggtttggataatggagttaataccataaat
atagtgccttcagagaataagaagttttttgatcaaattgatgttttatatgaaactgct
gaaaaatatgctcaaatgcaaagcgacttaaataatggggtaaaaaaaacacaattagct
aatgagttggttgcccagtatttaagaaaggatgactacaaagggtggaagtgggtccct
accgcaggccagattgatcctatttatcgtgaatgggcagtaaagcgctag

DBGET integrated database retrieval system