KEGG   Bacillus subtilis subsp. subtilis 168: BSU14072Help
Entry
BSU14072          CDS       T00010                                 

Gene name
ykzU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303033
NCBI-ProteinID: YP_003097724
UniProt: C0H408
Position
1480933..1481451
Genome map
AA seq 172 aa AA seqDB search
MATYNAIIYSGGYSQTLRDFAGWTGDLLTTIQDMKLHAQEFNSPYDAAMKIIGNMYQFSL
DDLFSDVDAINLANKTSVGANAQPLNIAIRDYYSNNDCMNRFTQFVNNRFDGSLDKIFSE
AEYYLNTNLDPVVVPIRLAFKRAFDVEDYSEEIGKITAQAFRDVIEKKMISE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttataatgccattatttatagtggtggttactctcaaacactacgagatttt
gctggttggactggagatctattaacaacaatacaggacatgaaattacacgctcaagaa
tttaattcgccttatgatgcggctatgaaaataataggtaatatgtatcaatttagccta
gatgatttatttagtgatgtagatgcaattaatctagcgaataaaacatcagttggtgct
aatgcacaacctctaaatatcgcaattagagattattatagtaataatgactgtatgaat
aggttcactcaatttgtaaataatagatttgatggttcgttagacaaaattttctctgaa
gcagagtattatttaaatacaaaccttgacccagttgttgttccaattaggttagccttt
aaacgtgcttttgatgttgaggattatagtgaagagattggaaaaataacagcacaagca
tttagagatgttatcgagaaaaaaatgatatctgaataa

DBGET integrated database retrieval system