KEGG   Bacillus subtilis subsp. subtilis 168: BSU14080
Entry
BSU14080          CDS       T00010                                 
Symbol
ykuH
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939211
NCBI-ProteinID: NP_389291
Pasteur: BG13292
BSORF: BG13292
UniProt: O31696 A0A6M4JJG5
Position
1481547..1482095
AA seq 182 aa
MKKLLKKLVVLFLSSLVIIFNVWYFIICAFSPEYYQNTNLTSNEIIRFEKLYHIDFPDET
KFIKAREYLAGPGGDTSAVLYVSLPTKRVEKVLSDYTYMKINYTDNVGSMYGVDVSKSVA
GLTTLTFGTYDKKGTFYNMKHDDDWMYKGTDWNLYFWTAASYNAVIFVFVLVIVKQMNKI
LN
NT seq 549 nt   +upstreamnt  +downstreamnt
ttgaagaaattgttaaaaaagttagttgtattatttttaagcagtttagttatcatcttt
aatgtttggtactttattatttgtgctttttccccagagtattatcaaaatacaaatctt
acttctaatgaaataataagatttgaaaaactataccacatagattttcctgatgaaaca
aaatttattaaagctagagagtatttggctgggcccggaggagatacgtcagctgtatta
tatgtgtctctgccaaccaagcgggtagaaaaagttttatctgattacacgtatatgaaa
ataaactatactgacaatgtcggttcaatgtatggagttgacgtttcaaagagtgtcgcc
ggtttaacaactcttacatttggcacttacgataaaaaaggaactttctataatatgaaa
catgatgatgattggatgtataaaggcactgactggaatctttacttttggacagctgct
agttataatgctgttatttttgtatttgttttggttattgtgaaacaaatgaataaaatt
cttaattaa

DBGET integrated database retrieval system