KEGG   Bacillus subtilis subsp. subtilis 168: BSU14090Help
Entry
BSU14090          CDS       T00010                                 

Gene name
ykuI
Definition
(RefSeq) EAL-domain containing protein YkuI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YkuI_C EAL dCache_1
Motif
Other DBs
NCBI-GeneID: 939207
NCBI-ProteinID: NP_389292
Pasteur: BG13293
BSORF: BG13293
UniProt: O35014
Structure
PDB: 

Position
1482248..1483471
Genome map
AA seq 407 aa AA seqDB search
MLDPLDILTNIDDVLPYYQAIFSAEEQKVVGYEVLGRILADSEIQSLGPFFLDAGIPEEY
KLEVDNRIIRQALDRFLEADSDLLIFMNQDANLLMLDHGESFLELLKEYEAKGIELHRFV
LEITEHNFEGDIEQLYHMLAYYRTYGIKIAVDNIGKESSNLDRIALLSPDLLKIDLQALK
VSQPSPSYEHVLYSISLLARKIGAALLYEDIEANFQLQYAWRNGGRYFQGYYLVSPSETF
LERDVLKQRLKTEFHQFITHEKKKLETVYEHSEQFYKRVHQAVTSLRKNNLSSDDDFIKK
LAEELTDCSFRIYMCDEEGDQLTGNVFKQDGEWIYQPEYAEKNWSWRPYFLENIMRMRNL
RKGFFSDLYSDLETGEMIRTFSYPMDDQMYLFIDLPYSYLYEQDGLI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgttggatccacttgatattttaacgaacattgatgatgtccttccatattaccaggcg
atttttagtgccgaggagcagaaggttgtcggatatgaggtgcttggacgaattttggca
gattcagaaatccaaagtctcgggcccttctttttagatgcggggatacccgaagaatat
aaattagaggttgataacagaattatccgccaggctcttgaccgctttttagaggcggat
tctgatctgctgatttttatgaatcaggatgccaatctgctgatgctggatcatggtgaa
agctttctggagcttctgaaagaatatgaagcgaagggaatcgaactccaccgttttgtg
cttgaaattacagagcacaattttgaaggggatattgagcagctctaccatatgcttgca
tactatcgtacatacggaattaaaatcgcagttgacaacatcggaaaagaaagcagcaac
ttggacagaatcgcgctgctctcaccagatctgttaaaaatcgatttgcaggcgctgaaa
gtgtcacagccgtcaccgtcatatgagcatgtgctgtacagcatatctttattagcaaga
aaaatcggtgcggcgctgctgtatgaagacattgaggcgaacttccagcttcagtacgcc
tggagaaacggaggccgctattttcagggctattacttagtgtctccatctgaaacgttt
ctagagagagatgtattgaaacaaagacttaaaactgaatttcaccaatttatcacacat
gagaaaaagaaactggagaccgtctatgagcactctgaacagttttacaaacgagtgcat
caggctgtgacctctttgagaaaaaacaatctgtcttctgatgatgactttattaaaaag
ctggcggaagagctgacagattgcagcttcaggatttacatgtgtgatgaagaaggcgat
cagctgacgggaaatgtgtttaagcaagatggagaatggatttatcagccggaatatgcg
gaaaagaactggagctggcgcccttattttctggagaacattatgagaatgagaaatctc
agaaaaggttttttcagtgatctgtacagtgatttggaaacaggtgaaatgatcagaacg
ttttcatatccgatggatgatcagatgtatttatttatagacttgccttattcttattta
tatgagcaggacggactgatttaa

DBGET integrated database retrieval system