KEGG   Bacillus subtilis subsp. subtilis 168: BSU14100Help
Entry
BSU14100          CDS       T00010                                 

Gene name
ykuJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1797 Thioredoxin_12 CX
Motif
Other DBs
NCBI-GeneID: 936162
NCBI-ProteinID: NP_389293
Pasteur: BG13294
BSORF: BG13294
UniProt: O34588
Structure
PDB: 

Position
1484117..1484356
Genome map
AA seq 79 aa AA seqDB search
MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPN
TYPFDNIDMVSIEIFELLQ
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaattaatgggtatcatcacacggctgcaaagtctgcaagaaacagcggaagcg
gctaacgagccaatgcagcgttatttcgaagtgaatggtgagaaaatatgcagtgttaaa
tatttcgaaaaaaatcaaacgtttgaactgacggttttccaaaagggtgaaaaacctaac
acatatccgtttgataatatcgacatggtttccatcgaaatctttgaacttcttcagtaa

DBGET integrated database retrieval system