KEGG   Bacillus subtilis subsp. subtilis 168: BSU14100
Entry
BSU14100          CDS       T00010                                 

Symbol
ykuJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1797 Thioredoxin_12 CX
Other DBs
NCBI-GeneID: 936162
NCBI-ProteinID: NP_389293
Pasteur: BG13294
BSORF: BG13294
UniProt: O34588 A0A6M4JMJ3
Structure
Position
1484117..1484356
AA seq 79 aa
MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPN
TYPFDNIDMVSIEIFELLQ
NT seq 240 nt   +upstreamnt  +downstreamnt
atgtcacaattaatgggtatcatcacacggctgcaaagtctgcaagaaacagcggaagcg
gctaacgagccaatgcagcgttatttcgaagtgaatggtgagaaaatatgcagtgttaaa
tatttcgaaaaaaatcaaacgtttgaactgacggttttccaaaagggtgaaaaacctaac
acatatccgtttgataatatcgacatggtttccatcgaaatctttgaacttcttcagtaa

DBGET integrated database retrieval system