KEGG   Bacillus subtilis subsp. subtilis 168: BSU14110Help
Entry
BSU14110          CDS       T00010                                 

Gene name
ykuK
Definition
(RefSeq) hypothetical protein
  KO
K09776  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU14110 (ykuK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNaseH_like STELLO
Motif
Other DBs
NCBI-GeneID: 939213
NCBI-ProteinID: NP_389294
Pasteur: BG13295
BSORF: BG13295
UniProt: O34776
Position
1484466..1484984
Genome map
AA seq 172 aa AA seqDB search
MADSFLFYNLSEAQMTFQDVMERLKAFVQKDPRSSYVLSIGTDSQVYRDYTKFITALHLH
RTGKGAWGCLKNHTVDRPIHSLREKISLETAYSQETAAHILDGHLMDITDLLLPFTGEGA
DLTFEVHLDIGKKGLTKDLIQEMTGRITSMGIEAKIKPDSYTAFSYANRFTK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgattcttttctgttttataatctttcagaagcacagatgacctttcaagatgtg
atggaacggcttaaagcctttgttcaaaaggacccccgttcttcttatgtgttatcgatc
ggaaccgattcacaggtttaccgcgattacacaaagtttattaccgcattgcatttgcat
cgtacaggcaagggagcttggggctgcttgaaaaatcatacagtcgacagacccatacat
agccttcgggagaagatttcgttagaaacggcgtacagccaagaaacggccgctcatatt
cttgatggacacttaatggatattaccgatctgctcctgccctttaccggtgagggggcg
gatcttacctttgaagttcacttggatattgggaaaaaagggcttacaaaagatctgatc
caagaaatgactggacgtattacctccatggggattgaggccaaaataaagccggattca
tacactgccttcagctatgcaaatcgtttcacaaaataa

DBGET integrated database retrieval system