KEGG   Bacillus subtilis subsp. subtilis 168: BSU14120Help
Entry
BSU14120          CDS       T00010                                 

Gene name
ykzF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AbbA_antirepres Qua1
Motif
Other DBs
NCBI-GeneID: 939703
NCBI-ProteinID: NP_389295
Pasteur: BG13334
BSORF: BG13334
UniProt: O31697
Structure
PDB: 

Position
1485118..1485315
Genome map
AA seq 65 aa AA seqDB search
MRMSLIGERFTEEEQKLLLNILINHEYAIELLSSEINDIETGTKNVDGTTYKKLVTLYDR
FRFEN
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
ttgcgaatgagtcttatcggtgaacgatttacagaagaagaacaaaaacttctgctgaat
atcctgatcaaccatgagtatgccatcgagctattaagcagtgagatcaacgatatagag
acagggaccaaaaacgttgacggaaccacctacaaaaaacttgtaacgctatacgaccga
tttcgatttgaaaattaa

DBGET integrated database retrieval system