KEGG   Bacillus subtilis subsp. subtilis 168: BSU14130Help
Entry
BSU14130          CDS       T00010                                 

Gene name
ykuL
Definition
(RefSeq) CBS domain-containing protein YkuL
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBS ArgoL2
Motif
Other DBs
NCBI-GeneID: 939199
NCBI-ProteinID: NP_389296
Pasteur: BG13296
BSORF: BG13296
UniProt: O31698
Structure
PDB: 

Position
1485453..1485896
Genome map
AA seq 147 aa AA seqDB search
MISLQSDQLLEATVGQFMIEADKVAHVQVGNNLEHALLVLTKTGYTAIPVLDPSYRLHGL
IGTNMIMNSIFGLERIEFEKLDQITVEEVMLTDIPRLHINDPIMKGFGMVINNGFVCVEN
DEQVFEGIFTRRVVLKELNKHIRSLNK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgataagcttacaatcagatcaacttcttgaggcaacagtcggacaatttatgattgag
gcggacaaagtagcgcacgtgcaagtcggaaataaccttgagcatgcattattagtattg
acaaaaaccggatacacagccatcccggttctggatccttcctaccgtttacatggctta
atcgggacaaatatgatcatgaacagtatttttggacttgagcgaattgagtttgaaaag
cttgaccaaatcactgttgaggaagtcatgctgaccgacattccgcgccttcatatcaat
gatccgattatgaagggattcggcatggtcattaataacggatttgtctgtgttgaaaat
gacgagcaggtatttgaagggatttttacgagaagagtcgttttaaaggaattgaataag
catatacgctcattgaataagtag

DBGET integrated database retrieval system