KEGG   Bacillus subtilis subsp. subtilis 168: BSU14140Help
Entry
BSU14140          CDS       T00010                                 

Gene name
ccpC
Definition
(RefSeq) LysR family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 HTH_30 MarR_2
Motif
Other DBs
NCBI-GeneID: 939197
NCBI-ProteinID: NP_389297
Pasteur: BG13297
BSORF: BG13297
UniProt: O34827
Position
1486045..1486926
Genome map
AA seq 293 aa AA seqDB search
MQLQELHMLVVLAEELNMRKAAERLFVSQPALSQRLQTIEKAWGTKIFLRSQKGLTVTPA
GEKIIQFANDVTLEQERIRENIDELEGEIHGTLKLAVASIIGQHWLPKVLKTYVEKYPNA
KISLITGWSSEMLKSLYEDQVHIGIIRGNPEWKGRKDYLMTDHLYLVDTEISCIEDIAHT
ERPFIQFKSDSTYFQEIQHWWHQKFKTSPKQTILVDQIETCKQMALHGIGYAILPSVTLQ
NEDKVNKMPLLDMKGHPIGRDTWLLGYEPAFELKQVQAFVQVIKDMLDQENPF
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcagcttcaagagcttcatatgctcgtagttttagctgaggaattaaatatgagaaag
gcggcagaacggctttttgtatctcagccggctttatctcagcgcttacaaaccattgaa
aaggcgtggggaacaaaaatctttttaagatctcaaaaaggattaacggtaacgcccgcc
ggtgagaaaatcattcagtttgcgaatgatgtgacattagagcaggaaagaataagagaa
aatattgacgagcttgaaggtgaaattcacggcacattgaagcttgccgtcgcctccata
atcggtcagcattggctccctaaagtcctgaagacgtatgtggaaaagtatccgaatgca
aagatctcgctcataaccgggtggagcagcgaaatgctgaaaagcttgtatgaggatcag
gttcatatcggcattataagaggcaaccctgagtggaaggggcgcaaagattacttaatg
acagatcatctgtatttagtggatactgaaatttcctgcatcgaagatattgcccataca
gaacgtccgtttatccagtttaaaagtgacagcacttattttcaggaaattcagcactgg
tggcatcaaaaatttaaaacgtcgccgaaacagacgatattggttgatcagattgaaacg
tgcaaacagatggcgctgcacggaatcggttatgccattttgccgtctgttacccttcaa
aatgaagataaagtgaataaaatgcctcttttagacatgaaagggcatccgatcggtcgg
gatacatggttattaggttatgagcctgcctttgaactgaaacaagttcaagcttttgta
caagtgataaaggatatgctggatcaggaaaatccattttaa

DBGET integrated database retrieval system