KEGG   Bacillus subtilis subsp. subtilis 168: BSU14150Help
Entry
BSU14150          CDS       T00010                                 

Gene name
ykuN
Definition
(RefSeq) flavodoxin
  KO
K03839  flavodoxin I
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    BSU14150 (ykuN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_1 Flavodoxin_3 Flavodoxin_5 Flavodoxin_NdrI DUF3152
Motif
Other DBs
NCBI-GeneID: 939194
NCBI-ProteinID: NP_389298
Pasteur: BG13298
BSORF: BG13298
UniProt: O34737
Position
1487038..1487514
Genome map
AA seq 158 aa AA seqDB search
MAKALITYASMSGNTEDIAFIIKDTLQEYELDIDCVEINDMDASCLTSYDYVLIGTYTWG
DGDLPYEAEDFFEEVKQIQLNGLKTACFGSGDYSYPKFCEAVNLFNVMLQEAGAAVYQET
LKIELAPETDEDVESCRAFARGFLAWADYMNKEKIHVS
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagccttgattacatatgccagcatgtcaggaaatacagaagacattgccttc
ataataaaagatacgcttcaggaatatgagttggatatcgattgtgtcgagataaatgat
atggatgcgtcttgtttaacctcctatgattatgtactgattggcacctatacatggggg
gacggcgatttgccctacgaagcggaggattttttcgaagaggtcaaacagattcagctt
aatggtttaaaaacagcctgcttcgggtctggcgattattcttatccaaagttttgcgaa
gcggtgaatttgttcaatgtcatgctgcaagaggcgggagctgctgtttaccaggaaaca
ctaaaaattgaattagcgcctgaaacagatgaagatgtggaaagctgccgagcgtttgcg
agaggttttcttgcatgggcagattatatgaacaaggaaaaaatccatgtttcataa

DBGET integrated database retrieval system