KEGG   Bacillus subtilis subsp. subtilis 168: BSU14160Help
Entry
BSU14160          CDS       T00010                                 

Gene name
ykuO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ_3 BNR Sortilin-Vps10 BNR_6 Cu-oxidase_3
Motif
Other DBs
NCBI-GeneID: 939196
NCBI-ProteinID: NP_389299
Pasteur: BG13299
BSORF: BG13299
UniProt: O34879
Position
1487504..1488397
Genome map
AA seq 297 aa AA seqDB search
MFHKGATAVTASAFSGYFVAVQREGIFHYSLEQGWRKLFRLKSKIHCISYIGPYLFGVGE
KGTVIRSADEGKTWTMSSFPTNATVWAITGRNNGFVCAHGKHCIYVSDDFGVSWRVAKPF
AEFHNPPVIRSLCLHGGNLFIGTQIHEYFGGIWAYDIKRDTVQVVKKEKNRMTASMLVFN
ENWLVAAMGSVKGKHGAVTVRNLLNGEEFTIQSSMIRNEESFLDLSEDDGIIYVTTTQDE
NGFSRIYQVDLEARSLKWFDTIKGHGWRVANQKENFFCAGLYECKFVQPYEVSAMIH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtttcataaaggggcaaccgctgttacggcatcggcgttttctggatattttgtggcg
gtacaaagagaaggcatttttcattactctttggagcagggctggagaaagctttttcgt
ttgaaaagtaagatacactgtatcagctacatagggccttacttatttggcgttggtgaa
aagggaacagtcattcgttcggctgatgaagggaaaacctggacgatgtcgagctttccg
acaaatgcaacagtgtgggcgattaccggcagaaacaacgggtttgtctgcgcccacggt
aagcattgtatttatgtatcggatgattttggtgtctcatggcgcgtagccaaacctttt
gccgaatttcataatccccctgttatccggtcgttatgccttcacgggggcaatctcttt
atcggcacgcaaatacacgaatattttggcggcatttgggcttacgacattaagcgtgac
actgtccaagttgtcaaaaaagaaaaaaaccggatgacggcatccatgctcgtgttcaat
gaaaattggctggtggcggcgatgggttctgtgaaaggaaagcacggtgctgtcactgta
aggaatcttttgaatggtgaagaattcaccatacaatccagtatgatcagaaatgaagaa
tcatttcttgatctttcagaggatgatggcattatatatgtcactacaacacaagatgaa
aatggtttttcgagaatttaccaggttgatctcgaagcccggtcgttaaaatggttcgat
accattaagggacatggatggagagtggccaatcagaaagagaatttcttttgcgcaggc
ttgtatgaatgtaaatttgtccagccgtacgaagtttcagcaatgattcattag

DBGET integrated database retrieval system